MTCP1 Antibody (1G12)

Images

 
Western Blot: MTCP1 Antibody (1G12) [H00004515-M05] - Analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody (M05), clone 1G12. Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7 KDa). ...read more
Sandwich ELISA: MTCP1 Antibody (1G12) [H00004515-M05] - Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTCP1 Antibody (1G12) Summary

Immunogen
MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Specificity
MTCP1 - mature T-cell proliferation 1 (1G12)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTCP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTCP1 Antibody (1G12)

  • mature T-cell proliferation 1
  • P13MTCP1

Background

This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. The gene has two ORFs that encode two different proteins. The upstream ORF encodes a 13kDa protein that is a member of the TCL1 family; this protein may be involved in leukemogenesis. The downstream ORF encodes an 8kDa protein that localizes to mitochondria. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43253
Species: Hu
Applications: Flow, IHC, IHC-P, IP, WB
AF6794
Species: Hu
Applications: IHC
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NBP1-76831
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-01732
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-98280
Species: Hu
Applications: WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-87431
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004515-M05
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for MTCP1 Antibody (H00004515-M05) (0)

There are no publications for MTCP1 Antibody (H00004515-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCP1 Antibody (H00004515-M05) (0)

There are no reviews for MTCP1 Antibody (H00004515-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTCP1 Antibody (H00004515-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCP1 Products

Bioinformatics Tool for MTCP1 Antibody (H00004515-M05)

Discover related pathways, diseases and genes to MTCP1 Antibody (H00004515-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCP1 Antibody (H00004515-M05)

Discover more about diseases related to MTCP1 Antibody (H00004515-M05).
 

Pathways for MTCP1 Antibody (H00004515-M05)

View related products by pathway.

PTMs for MTCP1 Antibody (H00004515-M05)

Learn more about PTMs related to MTCP1 Antibody (H00004515-M05).
 

Research Areas for MTCP1 Antibody (H00004515-M05)

Find related products by research area.

Blogs on MTCP1

There are no specific blogs for MTCP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCP1 Antibody (1G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTCP1
Entrez
Uniprot