TCF7L1/TCF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCF7L1/TCF3 Antibody [NBP2-56055] - Staining of human cell line RH-30 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF7L1/TCF3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
Specificity
Specificity of human TCF7L1/TCF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF7L1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCF7L1/TCF3 Recombinant Protein Antigen (NBP2-56055PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TCF7L1/TCF3 Antibody

  • HMG box transcription factor 3
  • TCF3
  • TCF-3
  • TCF7L1
  • transcription factor 7-like 1 (T-cell specific, HMG-box)
  • transcription factor 7-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
H00006938-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB100-56511
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00001879-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
H00006932-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-38790
Species: Hu, Rt
Applications: IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-56055
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TCF7L1/TCF3 Antibody (NBP2-56055) (0)

There are no publications for TCF7L1/TCF3 Antibody (NBP2-56055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF7L1/TCF3 Antibody (NBP2-56055) (0)

There are no reviews for TCF7L1/TCF3 Antibody (NBP2-56055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCF7L1/TCF3 Antibody (NBP2-56055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TCF7L1/TCF3 Products

Bioinformatics Tool for TCF7L1/TCF3 Antibody (NBP2-56055)

Discover related pathways, diseases and genes to TCF7L1/TCF3 Antibody (NBP2-56055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF7L1/TCF3 Antibody (NBP2-56055)

Discover more about diseases related to TCF7L1/TCF3 Antibody (NBP2-56055).
 

Pathways for TCF7L1/TCF3 Antibody (NBP2-56055)

View related products by pathway.

PTMs for TCF7L1/TCF3 Antibody (NBP2-56055)

Learn more about PTMs related to TCF7L1/TCF3 Antibody (NBP2-56055).
 

Research Areas for TCF7L1/TCF3 Antibody (NBP2-56055)

Find related products by research area.

Blogs on TCF7L1/TCF3

There are no specific blogs for TCF7L1/TCF3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF7L1/TCF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7L1