TCF4 Antibody - BSA Free

Immunohistochemistry-Frozen: TCF4 Antibody [NBP1-88633] - Frozen mouse heart sections. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: TCF4 Antibody [NBP1-88633] -Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: TCF4 Antibody [NBP1-88633] -Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TCF4 Antibody [NBP1-88633] -Staining of human duodenum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TCF4 Antibody [NBP1-88633] -Staining of human kidney shows strong nuclear positivity in cells in tubules.

ChIP-Exo-Seq composite graph for Anti-TCF4 (NBP1-88633) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP, Mycoplasma, Single-Cell Western
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCF4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TCF4 Antibody - BSA Free (NBP1-88633) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TCF4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 31091443)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen Validated from a verified customer review.
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated Reported in scientific literature (PMID: 31091443)
  • Single Cell Western Reported in scientific literature (PMID: 31091443)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TCF4 Protein (NBP1-88633PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TCF4 Antibody - BSA Free

• BHLHB19
• bHLHb19E2-2
• Class B basic helix-loop-helix protein 19
• Immunoglobulin transcription factor 2
• ITF-2
• ITF2PTHS
• MGC149724
• SEF-2
• SEF2-1
• SEF2-1A
• SEF2-1B
• SEF2MGC149723
• SL3-3 enhancer factor 2
• TCF-4
• transcription factor 4

Background

TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is expressed predominantly in pre-B-cells, although it is found in other tissues as well. Multiple alternatively spliced transcript variants that encode different proteins have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCF4 Antibody (NBP1-88633)(3)

Publications using NBP1-88633

• Saegusa M, Hashimura M, Kuwata T et al. Sox4 functions as a positive regulator of Beta -catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Lab Invest 2012-04-01 [PMID: 22231735]
• Tauil LH, Mader AMA, Tauil TH, Pires A. Immunohistochemistry expression of TCF4 protein on carcinoma, adenoma and non neoplastic colorectal mucosa. Journal of Coloproctology 2014-02-04 (IHC-P, Human)
• Kuo T, Damle M, Gonzalez BJ et al. Mesenchymal Stromal Cells Are Required for Regeneration and Homeostatic Maintenance of Skeletal Muscle Cell Rep 2019-05-14 [PMID: 31091443] (Single Cell Western, KD, ICC/IF, Mouse)

Review for TCF4 Antibody (NBP1-88633) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: yidong wang IHC Mouse 05/03/2017

Summary

• Application: Immunohistochemistry
• Sample Tested: Frozen mouse heart sections
• Species: Mouse

Bioinformatics

• Gene Symbol: TCF4
• Entrez:
  • 6925(Human)
• Uniprot:
  • P15884(Human)