TCF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCF4 Antibody [NBP1-88633] - Image is courtesy of customer review
Immunohistochemistry-Paraffin: TCF4 Antibody [NBP1-88633] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity per customer review.
Control Peptide
TCF4 Protein (NBP1-88633PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88633 in the following applications:

Publications
Read Publications using
NBP1-88633 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF4 Antibody

  • BHLHB19
  • bHLHb19E2-2
  • Class B basic helix-loop-helix protein 19
  • Immunoglobulin transcription factor 2
  • ITF-2
  • ITF2PTHS
  • MGC149724
  • SEF-2
  • SEF2-1
  • SEF2-1A
  • SEF2-1B
  • SEF2MGC149723
  • SL3-3 enhancer factor 2
  • TCF-4
  • transcription factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6116
Species: Hu
Applications: WB, ICC
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF4885
Species: Mu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF5596
Species: Hu
Applications: WB, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P

Publications for TCF4 Antibody (NBP1-88633)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-88633 Applications Species
Saegusa M, Hashimura M, Kuwata T et al. Sox4 functions as a positive regulator of Beta -catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Lab Invest 2012 Apr [PMID: 22231735]
Tauil LH, Mader AMA, Tauil TH, Pires A. Immunohistochemistry expression of TCF4 protein on carcinoma, adenoma and non neoplastic colorectal mucosa. Journal of Coloproctology 2014 Feb 04 (IHC-P, Human) IHC-P Human

Review for TCF4 Antibody (NBP1-88633) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IHC.

Reviews using NBP1-88633:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry TCF4 NBP1-88633
Enlarge
reviewed by:
yidong wang
IHC Mouse 05/03/2017
View

Summary

ApplicationImmunohistochemistry
Sample TestedFrozen mouse heart sections
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCF4 Antibody (NBP1-88633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF4 Products

Bioinformatics Tool for TCF4 Antibody (NBP1-88633)

Discover related pathways, diseases and genes to TCF4 Antibody (NBP1-88633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF4 Antibody (NBP1-88633)

Discover more about diseases related to TCF4 Antibody (NBP1-88633).
 

Pathways for TCF4 Antibody (NBP1-88633)

View related products by pathway.

PTMs for TCF4 Antibody (NBP1-88633)

Learn more about PTMs related to TCF4 Antibody (NBP1-88633).
 

Research Areas for TCF4 Antibody (NBP1-88633)

Find related products by research area.

Blogs on TCF4.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

yidong wang
05/03/2017
Application: IHC
Species: Mouse

Bioinformatics

Gene Symbol TCF4
Entrez
Uniprot