TCF7/TCF1 Antibody (1D2)

Images

 
Western Blot: TCF7/TCF1 Antibody (1D2) [H00006932-M01] - Analysis of TCF7 expression in transfected 293T cell line by TCF7 monoclonal antibody (M01), clone 1D2.Lane 1: TCF7 transfected lysate(41.6 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: TCF7/TCF1 Antibody (1D2) [H00006932-M01] - Analysis of monoclonal antibody to TCF7 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TCF7/TCF1 Antibody (1D2) [H00006932-M01] - Analysis of monoclonal antibody to TCF7 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
Sandwich ELISA: TCF7/TCF1 Antibody (1D2) [H00006932-M01] - Detection limit for recombinant GST tagged TCF7 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCF7/TCF1 Antibody (1D2) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TCF7 (NP_003193, 287 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
Localization
Nuclear
Specificity
TCF7 - transcription factor 7 (T-cell specific, HMG-box)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCF7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using
H00006932-M01 in the following applications:

  • B/N
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF7/TCF1 Antibody (1D2)

  • FLJ36364
  • MGC47735
  • T-cell factor 1
  • T-cell specific
  • TCF1
  • TCF7
  • TCF-7
  • transcription factor 7 (T-cell specific, HMG-box)

Background

The T cell specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCF7/TCF1 Antibody (H00006932-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: B/N, WB.


Filter By Application
B/N
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TCF7/TCF1 Antibody (H00006932-M01) (0)

There are no reviews for TCF7/TCF1 Antibody (H00006932-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF7/TCF1 Antibody (H00006932-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF7/TCF1 Products

Research Areas for TCF7/TCF1 Antibody (H00006932-M01)

Find related products by research area.

Blogs on TCF7/TCF1

There are no specific blogs for TCF7/TCF1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF7/TCF1 Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7
Entrez
OMIM
Uniprot