TCF20 Antibody - BSA Free

Western Blot: TCF20 Antibody [NBP2-83631] - WB Suggested Anti-TCF20 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysateTCF20 is supported by BioGPS gene expression data to be expressed in OVCAR3

Immunohistochemistry-Paraffin: TCF20 Antibody [NBP2-83631] - Rabbit Anti-TCF20 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Nuclear (nuclear membrane). Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TCF20 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TCF20. Peptide sequence: HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TCF20 Antibody - BSA Free

• transcription factor 20
• AR1
• SPBP
• transcription factor 20 (AR1)

Background

The protein encoded by the TCF20 gene binds a platelet-derived growth factor-responsive element in the matrix metalloproteinase 3 (stromelysin 1) promoter. The protein localizes to the nucleus and displays DNA-binding and transactivation activities. It is thought to be a transcriptional coactivator, enhancing the activity of transcription factors such as JUN and SP1. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCF20 Antibody (NBP2-83631)(2)

Publications using NBP2-83631

• Oh J, Kang C, Wang E et al. Excess Growth Hormone Facilitates the Aggressiveness and Metastasis of Breast Cancer in Acromegaly Available at SSRN 2023-05-03
• Mouti MA, Deng S, Pook M et al. KMT2A associates with PHF5A-PHF14-HMG20A-RAI1 subcomplex in pancreatic cancer stem cells and epigenetically regulates their characteristics Nature communications 2023-09-14 [PMID: 37709746] (WB, Human)

Bioinformatics

• Gene Symbol: TCF20