Home » TCERG1 » TCERG1 Antibodies » TCERG1 Antibody

TCERG1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TCERG1 Antibody [NBP2-57767] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: TCERG1 Antibody [NBP2-57767] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TCERG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
Specificity
Specificity of human TCERG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCERG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCERG1 Recombinant Protein Antigen (NBP2-57767PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TCERG1 Antibody

  • CA150TATA box-binding protein-associated factor 2S
  • co-activator of 150 kDa
  • TAF2SMGC133200
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD
  • TATA box-binding protein-associated factor 2S
  • transcription elongation regulator 1
  • Transcription factor CA150
  • Urn1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Huntingtin
Antibody (JB89-34)
NBP2-75531
Western Blot: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of Huntingtin on A431 cell using anti-Huntingtin antibody at 1/500 dilution.
Immunohistochemistry-Paraffin: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of paraffin-embedded rat brain tissue using anti-Huntingtin antibody. Counter stained with hematoxylin.
Flow Cytometry: Huntingtin Antibody (JB89-34) [NBP2-75531] - Analysis of SH-SY-5Y cells with Huntingtin antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
FNBP3 Antibody
NBP1-87933
Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).
Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

SLC6A4/5-HTTLPR/Seroto ...
NB100-1892
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Human Colon lysate, 35 ug protein in RIPA buffer. Antibody at 2 ug/mL. Detection by chemiluminescence.
Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Splicing Factor 1
Antibody (2E12)
H00007536-M01
Western Blot: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01), clone 2E12.Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of monoclonal antibody to SF1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Splicing Factor 1 Antibody (2E12) [H00007536-M01] - Analysis of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
HIV TAT specific
factor 1 Antibody
NBP3-03306
Western Blot: HIV TAT specific factor 1 Antibody [NBP3-03306] - Analysis of extracts of various cell lines, using HIV TAT specific factor 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/Immunofluorescence: HIV TAT specific factor 1 Antibody [NBP3-03306] - Analysis of C6 cells using HIV TAT specific factor 1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: HIV TAT specific factor 1 Antibody [NBP3-03306] - Paraffin-embedded mouse testis using HIV TAT specific factor 1 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
TAT Antibody
46420002
ELISA: TAT Antibody [46420002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human testis show strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Glutamate Receptor
6 Antibody
NBP1-91946
Western Blot: Glutamate Receptor 6 Antibody [NBP1-91946] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: Glutamate Receptor 6 Antibody [NBP1-91946] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Western Blot: Glutamate Receptor 6 Antibody [NBP1-91946] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NMDAR2A Antibody
NB300-105
Western Blot: NMDAR2A Antibody [NB300-105]
Immunohistochemistry: NMDAR2A Antibody [NB300-105] - Immunostaining of rabbit retina showing NR2A in the rod and cone photoreceptors in the outer plexiform layer as well as the entire inner plexiform layer.
(8 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
DACH1 Antibody
NBP2-27192
Western Blot: DACH1 Antibody [NBP2-27192] - Analysis of DACH1 in human placenta lysate using NBP2-27192 at 5 ug/ml.
Immunohistochemistry-Paraffin: DACH1 Antibody [NBP2-27192] - Analysis of Dach1 in formalin-fixed, paraffin-embedded human kidney tissue using an isotype control (top left) and this antibody (bottom left, right) at 5 ug/ml.
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
TREX1 Antibody
NBP1-76977
Western Blot: TREX1 Antibody [NBP1-76977] - Analysis of human spleen tissue lysate with TREX1 antibody at (A) 0.5 ug/mL and (B) 1 ug/mL.
Immunocytochemistry/Immunofluorescence: TREX1 Antibody [NBP1-76977] - Human spleen cells.
Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-76977] - Analysis of human spleen tissue with TREX1 antibody at 2.5 ug/mL.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Geminin Antibody
(1A8)
H00051053-M01
Western Blot: Geminin Antibody (1A8) [H00051053-M01] - Analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01), clone 1A8.Lane 1: GMNN transfected lysate(23.6 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Geminin Antibody (1A8) [H00051053-M01] - Analysis of monoclonal antibody to GMNN on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Geminin Antibody (1A8) [H00051053-M01] - Analysis of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1 ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
DFF40/CAD Antibody
NBP1-77009
Western Blot: DFF40/CAD Antibody [NBP1-77009] - Analysis of 50 ug of murine lung tissue lysate with anti-CAD (I17) at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: DFF40/CAD Antibody [NBP1-77009] - Staining of CAD in mouse kidney tissue with CAD antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: DFF40/CAD Antibody [NBP1-77009] - Staining of CAD in mouse kidney tissue with CAD antibody at 5 ug/ml.
(3 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Apolipoprotein
E/ApoE Antibody (WUE-
NB110-60531
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE was detected in immersion fixed paraffin-embedded sections of human liver using anti-human mouse monoclonal antibody (Catalog # NB110-60531) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(21 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Thioredoxin-1
Antibody
NBP2-52983
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-52983] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Thioredoxin at a 1:100 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) [NB100-690] was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-52983] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Thioredoxin at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Thioredoxin Antibody [NBP2-52983] - PC12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Thioredoxin at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GHITM Antibody
NBP1-47217
Western Blot: GHITM Antibody [NBP1-47217] - Analysis of Human Cerebellum (A), Duodenum (B) and Heart (C) cell lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: GHITM Antibody [NBP1-47217] - Analysis of HeLa cell lysate (35ug protein in RIPA buffer) using NBP1-47217 at 0.3ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
NMDAR2B Antibody
NB300-106
Western Blot: NMDAR2B Antibody [NB300-106] - The blots show the examples of immunobands against NMDAR2B (C) and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (http://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY licence.
Flow Cytometry: NMDAR2B Antibody [NB300-106] - NMDA2B receptor expression on CD4+ T cells. Image supplied by review from confirmed customer.
Western Blot: NMDAR2B Antibody [NB300-106]
(3 Reviews)
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
GEM Antibody
NBP1-58906
Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.
Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.
Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TCERG1 Antibody (NBP2-57767) (0)

There are no publications for TCERG1 Antibody (NBP2-57767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCERG1 Antibody (NBP2-57767) (0)

There are no reviews for TCERG1 Antibody (NBP2-57767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCERG1 Antibody (NBP2-57767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TCERG1 Products

Bioinformatics Tool for TCERG1 Antibody (NBP2-57767)

Discover related pathways, diseases and genes to TCERG1 Antibody (NBP2-57767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCERG1 Antibody (NBP2-57767)

Discover more about diseases related to TCERG1 Antibody (NBP2-57767).
 

Pathways for TCERG1 Antibody (NBP2-57767)

View related products by pathway.

PTMs for TCERG1 Antibody (NBP2-57767)

Learn more about PTMs related to TCERG1 Antibody (NBP2-57767).
 

Research Areas for TCERG1 Antibody (NBP2-57767)

Find related products by research area.

Blogs on TCERG1

There are no specific blogs for TCERG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCERG1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TCERG1