TCERG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCERG1 Antibody [NBP2-57767] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCERG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
Specificity
Specificity of human TCERG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCERG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCERG1 Recombinant Protein Antigen (NBP2-57767PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TCERG1 Antibody

  • CA150TATA box-binding protein-associated factor 2S
  • co-activator of 150 kDa
  • TAF2SMGC133200
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD
  • TATA box-binding protein-associated factor 2S
  • transcription elongation regulator 1
  • Transcription factor CA150
  • Urn1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03306
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76977
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-77009
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47217
Species: Hu
Applications: WB, PEP-ELISA
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TCERG1 Antibody (NBP2-57767) (0)

There are no publications for TCERG1 Antibody (NBP2-57767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCERG1 Antibody (NBP2-57767) (0)

There are no reviews for TCERG1 Antibody (NBP2-57767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCERG1 Antibody (NBP2-57767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TCERG1 Products

Bioinformatics Tool for TCERG1 Antibody (NBP2-57767)

Discover related pathways, diseases and genes to TCERG1 Antibody (NBP2-57767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCERG1 Antibody (NBP2-57767)

Discover more about diseases related to TCERG1 Antibody (NBP2-57767).
 

Pathways for TCERG1 Antibody (NBP2-57767)

View related products by pathway.

PTMs for TCERG1 Antibody (NBP2-57767)

Learn more about PTMs related to TCERG1 Antibody (NBP2-57767).
 

Research Areas for TCERG1 Antibody (NBP2-57767)

Find related products by research area.

Blogs on TCERG1

There are no specific blogs for TCERG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCERG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCERG1