TCERG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TCERG1 Antibody [NBP2-39037] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: TCERG1 Antibody [NBP2-39037] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: TCERG1 Antibody [NBP2-39037] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: TCERG1 Antibody [NBP2-39037] - Staining in human cerebral cortex and liver tissues using anti-TCERG1 antibody. Corresponding TCERG1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCERG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TCERG1 Antibody - BSA Free (NBP2-39037) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKV
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCERG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TCERG1 Protein (NBP2-39037PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TCERG1 Antibody - BSA Free

• CA150TATA box-binding protein-associated factor 2S
• co-activator of 150 kDa
• TAF2SMGC133200
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD
• TATA box-binding protein-associated factor 2S
• transcription elongation regulator 1
• Transcription factor CA150
• Urn1

Background

CA150 is a nuclear factor that represses RNA polymerase II (RNAPII) transcription by inhibiting the elongation of transcripts. It has also been shown to be involved in the age onset of Huntington's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCERG1
• Uniprot:
  • O14776(Human)