TBX6 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS |
| Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TBX6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TBX6 Antibody - BSA Free
Background
Tbx6 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures. Transcript variants encoding different isoforms have been noted for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, ChIP
Publications for TBX6 Antibody (NBP2-68792) (0)
There are no publications for TBX6 Antibody (NBP2-68792).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TBX6 Antibody (NBP2-68792) (0)
There are no reviews for TBX6 Antibody (NBP2-68792).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TBX6 Antibody (NBP2-68792) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TBX6 Products
Blogs on TBX6