TBX15 Antibody - BSA Free

Western Blot: TBX15 Antibody [NBP2-49036] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

Immunohistochemistry-Paraffin: TBX15 Antibody [NBP2-49036] - Staining of human cerebral cortex shows moderate nuclear positivity in a subset of neurons.

ChIP-Exo-Seq composite graph for Anti-TBX15 (NBP2-49036) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBX15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBX15 Antibody - BSA Free (NBP2-49036) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQ
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBX15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 -1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBX15 Recombinant Protein Antigen (NBP2-49036PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TBX15 Antibody - BSA Free

• T-box 14
• T-box 15
• T-box protein 14
• T-box protein 15
• T-box transcription factor TBX14
• T-box transcription factor TBX15
• TBX14

Background

The T-box (TBX) motif is present in a family of genes whose structural features and expression patterns support their involvement in developmental gene regulation. The TBX gene family are largely conserved throughout metazoan evolution, and these genes code for putative transcription factors that share a uniquely defining DNA-binding domain. TBX genes are a family of developmental regulators with more than 20 members recently identified in invertebrates and vertebrates. Mutations in TBX genes are associated with the onset of several human diseases. Our understanding of functional mechanisms of TBX products has come mainly from the prototypical T/Brachyury, which is a transcription activator. The TBX genes constitute a family of transcriptional regulatory genes that are implicated in a variety of developmental processes ranging from the formation of germ layers to the organizational patterning of the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBX15