TBX20 Antibody

Images

 
Western Blot: TBX20 Antibody [NBP2-86846] - Host: Rabbit. Target Name: TBX20. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: TBX20 Antibody [NBP2-86846] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody
Western Blot: TBX20 Antibody [NBP2-86846] - Host: Rabbit. Target Name: TBX20. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 2ug/ml
Immunohistochemistry: TBX20 Antibody [NBP2-86846] - Human Muscle

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBX20 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TBX20. Peptide sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TBX20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBX20 Antibody

  • ASD4
  • T-box 20
  • T-box protein 20
  • T-box transcription factor TBX20
  • TBX20

Background

The Tbx20 gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box,and they are transcription factors involved in the regulation of developmental processes. This gene is essential forheart development. Mu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00006909-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
AF4509
Species: Hu
Applications: ICC, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-87992
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-17260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3168
Species: Hu
Applications: ICC, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
2926-BP/CF
Species: Hu
Applications: BA

Publications for TBX20 Antibody (NBP2-86846) (0)

There are no publications for TBX20 Antibody (NBP2-86846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX20 Antibody (NBP2-86846) (0)

There are no reviews for TBX20 Antibody (NBP2-86846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBX20 Antibody (NBP2-86846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX20 Products

Bioinformatics Tool for TBX20 Antibody (NBP2-86846)

Discover related pathways, diseases and genes to TBX20 Antibody (NBP2-86846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX20 Antibody (NBP2-86846)

Discover more about diseases related to TBX20 Antibody (NBP2-86846).
 

Pathways for TBX20 Antibody (NBP2-86846)

View related products by pathway.

PTMs for TBX20 Antibody (NBP2-86846)

Learn more about PTMs related to TBX20 Antibody (NBP2-86846).
 

Research Areas for TBX20 Antibody (NBP2-86846)

Find related products by research area.

Blogs on TBX20

There are no specific blogs for TBX20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX20