TBX20 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human TBX20. Peptide sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TBX20 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for TBX20 Antibody
Background
The Tbx20 gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box,and they are transcription factors involved in the regulation of developmental processes. This gene is essential forheart development. Mu
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for TBX20 Antibody (NBP2-86846) (0)
There are no publications for TBX20 Antibody (NBP2-86846).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TBX20 Antibody (NBP2-86846) (0)
There are no reviews for TBX20 Antibody (NBP2-86846).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TBX20 Antibody (NBP2-86846) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TBX20 Products
Bioinformatics Tool for TBX20 Antibody (NBP2-86846)
Discover related pathways, diseases and genes to TBX20 Antibody (NBP2-86846). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TBX20 Antibody (NBP2-86846)
Discover more about diseases related to TBX20 Antibody (NBP2-86846).
| | Pathways for TBX20 Antibody (NBP2-86846)
View related products by pathway.
|
PTMs for TBX20 Antibody (NBP2-86846)
Learn more about PTMs related to TBX20 Antibody (NBP2-86846).
| | Research Areas for TBX20 Antibody (NBP2-86846)
Find related products by research area.
|
Blogs on TBX20