![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human lymph node.](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0007.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human lymph node.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TBR1 Antibody - BSA Free (NBP2-62728) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBR1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TBR1 Antibody (NBP2-62728)Find related products by research area.
|
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBR1 |
![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Analysis in human cerebral cortex and kidney tissues using Anti-TBR1 antibody. Corresponding TBR1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0001.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Analysis in human cerebral cortex and kidney tissues using Anti-TBR1 antibody. Corresponding TBR1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0002.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0004.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human kidney shows low expression as expected.")
![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-TBR1 antibody NBP2-62728 (A) shows similar protein distribution across tissues to independent antibody NBP2-62729 (B).](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0005.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-TBR1 antibody NBP2-62728 (A) shows similar protein distribution across tissues to independent antibody NBP2-62729 (B).")
![Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human liver.](http://images.novusbio.com/fullsize/TBR1-Antibody-Immunohistochemistry-Paraffin-NBP2-62728-img0006.jpg "Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human liver.")
![Immunohistochemistry Reelin Antibody [Unconjugated]](https://images.novusbio.com/images2/Reelin_AF3820_Immunohistochemistry_18505.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-285202411422.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-immunohistochemistry-285202411531..jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Immunocytochemistry NeuroD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NeuroD1_AF2746_Immunocytochemistry_7291.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")