TBR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human lymph node.

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Analysis in human cerebral cortex and kidney tissues using Anti-TBR1 antibody. Corresponding TBR1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-TBR1 antibody NBP2-62728 (A) shows similar protein distribution across tissues to independent antibody NBP2-62729 (B).

Immunohistochemistry-Paraffin: TBR1 Antibody [NBP2-62728] - Staining of human liver.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBR1 Antibody - BSA Free (NBP2-62728) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBR1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for TBR1 Antibody - BSA Free

• MGC141978
• T-box brain protein 1
• T-box, brain, 1
• TBR-1
• T-brain-1
• TES-56

Background

TBR1 - T-box, brain, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBR1