TBCA Antibody - Azide and BSA Free

Western Blot: TBCA Antibody [NBP2-94247] - Analysis of extracts of various cell lines, using TBCA at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunohistochemistry-Paraffin: TBCA Antibody [NBP2-94247] - Paraffin-embedded rat brain using TBCA .

Immunohistochemistry-Paraffin: TBCA Antibody [NBP2-94247] - Paraffin-embedded mouse spinal cord using TBCA .

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TBCA Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1). MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBCA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TBCA Antibody - Azide and BSA Free

• CFA
• chaperonin cofactor A
• TCP1-chaperonin cofactor A
• tubulin folding cofactor A
• Tubulin-folding cofactor A
• tubulin-specific chaperone a

Background

Tubulin folding cofactor A, also known as TBCA, is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin in a quasi-native confirmation. This protein is essential for cell viability and its knockdown produces a decrease in the amount of soluble tubulin, modifications in microtubules and G1 cell cycle arrest. Recombinant human TBCA protein was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TBCA