TBCA Antibody


Western Blot: TBCA Antibody [NBP1-86288] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: TBCA Antibody [NBP1-86288] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & microtubules.
Immunohistochemistry-Paraffin: TBCA Antibody [NBP1-86288] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TBCA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEY
Specificity of human TBCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBCA Protein (NBP1-86288PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBCA Antibody

  • CFA
  • chaperonin cofactor A
  • TCP1-chaperonin cofactor A
  • tubulin folding cofactor A
  • Tubulin-folding cofactor A
  • tubulin-specific chaperone a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for TBCA Antibody (NBP1-86288) (0)

There are no publications for TBCA Antibody (NBP1-86288).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBCA Antibody (NBP1-86288) (0)

There are no reviews for TBCA Antibody (NBP1-86288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBCA Antibody (NBP1-86288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TBCA Products

Bioinformatics Tool for TBCA Antibody (NBP1-86288)

Discover related pathways, diseases and genes to TBCA Antibody (NBP1-86288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBCA Antibody (NBP1-86288)

Discover more about diseases related to TBCA Antibody (NBP1-86288).

Pathways for TBCA Antibody (NBP1-86288)

View related products by pathway.

PTMs for TBCA Antibody (NBP1-86288)

Learn more about PTMs related to TBCA Antibody (NBP1-86288).

Blogs on TBCA

There are no specific blogs for TBCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBCA Antibody and receive a gift card or discount.


Gene Symbol TBCA