TAZ/WWTR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining in human placenta and skeletal muscle tissues . Corresponding WWTR1 RNA-seq data are presented for the same tissues.

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies and cytosol. Antibody staining is shown in green.

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human colon shows moderate to strong nuclear positivity in a subset of lymphoid cells.

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human placenta shows moderate to strong nuclear positivity in endothelial cells.

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human renal cancer shows strong nuclear positivity in tumor cells.

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human skeletal muscle shows weak positivity in myocytes.

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Simple Western lane view shows a specific band for WWTR1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Electropherogram image(s) of corresponding Simple Western lane view. TAZ/WWTR1 antibody was used at 1:30 dilution on RT-4 lysates(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAZ/WWTR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAZ/WWTR1 Antibody - BSA Free (NBP1-85067) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TAZ/WWTR1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WWTR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID:22190458). IHC-Paraffin HIER pH6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 58 kDa
• Control Peptide:

  TAZ/WWTR1 Protein (NBP1-85067PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24658687)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAZ/WWTR1 Antibody - BSA Free

• FLJ27004
• FLJ45718
• TAZ
• TAZDKFZp586I1419
• transcriptional co-activator with PDZ-binding motif
• Transcriptional coactivator with PDZ-binding motif
• WW domain containing transcription regulator 1
• WW domain-containing transcription regulator protein 1
• WWTR1

Background

TAZ (transcriptional co-activator with PDZ-binding motif) was identified as a binding partner of 14-3-3 family of proteins which contains seven homologous proteins with ability to bind phosphorylated serine with certain sequence motifs, thereby involving in diverse cellular functions such as differentiation, cell cycle progression and apoptosis via their interaction with diverse intracellular phosphoproteins involved in signaling networks. TAZ is homologous to YAP and displays transcriptional co-activator function via interaction with PPXY-containing transcriptional factors through its WW domain. Several transcriptional factors such as Runx/PEBP2, AP2, C/EBP, c-Jun, Krox-20, Krox-24, MEF2B, NF-E2, Oct-4 and p73 containing proline-rich PPXY motif have been proposed as TAZ's interacting partners and TAZ is a major target of Hippo core kinase cascade which regulates organ size control as well as stem cell properties by governing cell proliferation and apoptosis processes Hippo mediated phosphorylation of YAP and TAZ leads to their sequestration into cytoplasm by interaction with 14-3-3 proteins and ubiquitination-dependent proteosomal degradation, thereby governing its distribution, protein levels and functionality also. TAZ interact primarily with transcriptional factors TEAD1-4 (TEADs) and activate expression of target genes such as CTGF, IGFBP3, ITGB2, Birc5/Survivin, Gli2, and Axl.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAZ/WWTR1 Antibody (NBP1-85067)(6)

Publications using NBP1-85067

• De-Armas-Conde N, Gonz�lez-Rico FJ, Ja�n-Torrejimeno I et al. Involvement of beta -catenin expression in hepatocellular carcinoma prognosis in a cohort of patients undergoing curative treatment. Surgery 2024-10-23 [PMID: 39448327]
• Slemmons KK, Crose LE, Rudzinski E et al. Role of the YAP Oncoprotein in Priming Ras-Driven Rhabdomyosarcoma. PLoS One 2015-01-01 [PMID: 26496700] (IF/IHC, Mouse)
• Sorrentino G, Ruggeri N, Specchia V et al. Metabolic control of YAP and TAZ by the mevalonate pathway. Nat Cell Biol 2014-04-01 [PMID: 24658687]
• Bhat KP, Salazar KL, Balasubramaniyan V et al. The transcriptional coactivator TAZ regulates mesenchymal differentiation in malignant glioma Genes Dev 2011-12-15 [PMID: 22190458] (IF/IHC, Human)
• Guo Y, Gabola M, Lattanzio R et al. Loss of cyclin A2 in murine colonic epithelial cells disrupts colon homeostasis by triggering DNA damage and dysplasia and high cyclin A2 expression is a good-prognosis factor in patients with colorectal cancer bioRxiv (IHC-P, Mouse)
• Niki Y, Kobayashi Y, Moriyama K Expression pattern of transcriptional enhanced associate domain family member 1 (Tead1) in developing mouse molar tooth Gene expression patterns : GEP 2021-05-10 [PMID: 33984529]

FAQs for TAZ/WWTR1 Antibody (NBP1-85067). (Showing 1 - 1 of 1 FAQs).

1. I want to know which TAZ primary antibody is best produced for WB (human and mouse)!
   • I would recommend this TAZ antibody: NB110-58359. This is also comes in a sample size.

Bioinformatics

• Gene Symbol: WWTR1
• Entrez:
  • 25937(Human)
• Uniprot:
  • Q9GZV5(Human)