TAZ/WWTR1 Antibody

Images

 
Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human colon shows moderate to strong nuclear positivity in a subset of lymphoid cells.
Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in human kidney tissue.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in endothelial cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Immunohistochemical staining of human renal cancer shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Immunohistochemical staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Simple Western lane view shows a specific band for WWTR1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Simple Western lane view shows a specific band for WWTR1 in 0.2 mg/ml of U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Electropherogram image(s) of corresponding Simple Western lane view. TAZ/WWTR1 antibody was used at 1:30 dilution on RT-4 lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAZ/WWTR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WWTR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
TAZ/WWTR1 Protein (NBP1-85067PEP)
Publications
Read Publications using
NBP1-85067 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24658687)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAZ/WWTR1 Antibody

  • FLJ27004
  • FLJ45718
  • TAZ
  • TAZDKFZp586I1419
  • transcriptional co-activator with PDZ-binding motif
  • Transcriptional coactivator with PDZ-binding motif
  • WW domain containing transcription regulator 1
  • WW domain-containing transcription regulator protein 1
  • WWTR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86860
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-42378
Species: Hu
Applications: WB, IHC

Publications for TAZ/WWTR1 Antibody (NBP1-85067)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for TAZ/WWTR1 Antibody (NBP1-85067) (0)

There are no reviews for TAZ/WWTR1 Antibody (NBP1-85067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAZ/WWTR1 Antibody (NBP1-85067). (Showing 1 - 1 of 1 FAQs).

  1. I want to know which TAZ primary antibody is best produced for WB (human and mouse)!
    • I would recommend this TAZ antibody: NB110-58359. This is also comes in a sample size.

Secondary Antibodies

 

Isotype Controls

Additional TAZ/WWTR1 Products

Bioinformatics Tool for TAZ/WWTR1 Antibody (NBP1-85067)

Discover related pathways, diseases and genes to TAZ/WWTR1 Antibody (NBP1-85067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAZ/WWTR1 Antibody (NBP1-85067)

Discover more about diseases related to TAZ/WWTR1 Antibody (NBP1-85067).
 

Pathways for TAZ/WWTR1 Antibody (NBP1-85067)

View related products by pathway.

PTMs for TAZ/WWTR1 Antibody (NBP1-85067)

Learn more about PTMs related to TAZ/WWTR1 Antibody (NBP1-85067).
 

Research Areas for TAZ/WWTR1 Antibody (NBP1-85067)

Find related products by research area.

Blogs on TAZ/WWTR1

There are no specific blogs for TAZ/WWTR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAZ/WWTR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WWTR1
Entrez
Uniprot