Orthogonal Strategies: Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining in human placenta and skeletal muscle tissues . Corresponding WWTR1 RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies and cytosol. Antibody staining is shown in green.
Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human colon shows moderate to strong nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human placenta shows moderate to strong nuclear positivity in endothelial cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human renal cancer shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human skeletal muscle shows weak positivity in myocytes.
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Simple Western lane view shows a specific band for WWTR1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Electropherogram image(s) of corresponding Simple Western lane view. TAZ/WWTR1 antibody was used at 1:30 dilution on RT-4 lysates(s).
Novus Biologicals Rabbit TAZ/WWTR1 Antibody - BSA Free (NBP1-85067) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TAZ/WWTR1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WWTR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC reported in scientific literature (PMID:22190458). IHC-Paraffin HIER pH6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 58 kDa
Reactivity reported in scientific literature (PMID: 24658687)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for TAZ/WWTR1 Antibody - BSA Free
FLJ27004
FLJ45718
TAZ
TAZDKFZp586I1419
transcriptional co-activator with PDZ-binding motif
Transcriptional coactivator with PDZ-binding motif
WW domain containing transcription regulator 1
WW domain-containing transcription regulator protein 1
WWTR1
Background
TAZ (transcriptional co-activator with PDZ-binding motif) was identified as a binding partner of 14-3-3 family of proteins which contains seven homologous proteins with ability to bind phosphorylated serine with certain sequence motifs, thereby involving in diverse cellular functions such as differentiation, cell cycle progression and apoptosis via their interaction with diverse intracellular phosphoproteins involved in signaling networks. TAZ is homologous to YAP and displays transcriptional co-activator function via interaction with PPXY-containing transcriptional factors through its WW domain. Several transcriptional factors such as Runx/PEBP2, AP2, C/EBP, c-Jun, Krox-20, Krox-24, MEF2B, NF-E2, Oct-4 and p73 containing proline-rich PPXY motif have been proposed as TAZ's interacting partners and TAZ is a major target of Hippo core kinase cascade which regulates organ size control as well as stem cell properties by governing cell proliferation and apoptosis processes Hippo mediated phosphorylation of YAP and TAZ leads to their sequestration into cytoplasm by interaction with 14-3-3 proteins and ubiquitination-dependent proteosomal degradation, thereby governing its distribution, protein levels and functionality also. TAZ interact primarily with transcriptional factors TEAD1-4 (TEADs) and activate expression of target genes such as CTGF, IGFBP3, ITGB2, Birc5/Survivin, Gli2, and Axl.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Guo Y, Gabola M, Lattanzio R et al. Loss of cyclin A2 in murine colonic epithelial cells disrupts colon homeostasis by triggering DNA damage and dysplasia and high cyclin A2 expression is a good-prognosis factor in patients with colorectal cancer bioRxiv (IHC-P, Mouse)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TAZ/WWTR1 Antibody - BSA Free and receive a gift card or discount.