![Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP3-05150] - Paraffin-embedded human lung cancer using TAx1BP1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunohistochemistry-Paraffin-NBP3-05150-img0001.jpg "Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP3-05150] - Paraffin-embedded human lung cancer using TAx1BP1 antibody at dilution of 1:100 (40x lens).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 709-789 of human TAX1BP1 (NP_006015.4). QHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAX1BP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TAX1BP1 Antibody (NBP3-05150)Find related products by research area.
|
|
Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TAX1BP1 |
![Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP3-05150] - Paraffin-embedded human breast cancer using TAx1BP1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/TAX1BP1-Antibody-Immunohistochemistry-Paraffin-NBP3-05150-img0002.jpg "Immunohistochemistry-Paraffin: TAX1BP1 Antibody [NBP3-05150] - Paraffin-embedded human breast cancer using TAx1BP1 antibody at dilution of 1:100 (40x lens).")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Immunohistochemistry_10516.jpg)
![Simple Western Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin2_AF4439_Simple_Western_17121.jpg)
![Western Blot Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Western_Blot_9589.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")