TANK Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TANK Antibody - BSA Free (NBP2-95201) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human TANK (NP_597841.1). MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TANK |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TANK Antibody - BSA Free
Background
The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor (TNFR) superfamily. TANK/I-TRAF (TRAF family member associated NF-kB activator/TRAF-interacting protein) that was first defined as a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction (reviewed in Bonif 2006). TANK/I-TRAF is thought to inhibit TRAF function by sequestering the TRAFs in the cytoplasm, thereby blocking their recruitment to the TNFR. TANK/I-TRAF has also been shown to bind to other proteins in the NF-kB signaling pathway, including NEMO. However, the role and different functions of TANK/I-TRAF in NF-kB signaling pathways remains to be fully elucidated. Recognizes TANK/I-TRAF, human TANK/I-TRAF is a 425 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Publications for TANK Antibody (NBP2-95201) (0)
There are no publications for TANK Antibody (NBP2-95201).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TANK Antibody (NBP2-95201) (0)
There are no reviews for TANK Antibody (NBP2-95201).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TANK Antibody (NBP2-95201) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TANK Products
Research Areas for TANK Antibody (NBP2-95201)
Find related products by research area.
|
Blogs on TANK