Talin1 Antibody - BSA Free

Western Blot: Talin1 Antibody [NBP1-87820] - Analysis in human cell lines U-251MG and MCF-7 using Anti-TLN1 antibody. Corresponding TLN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Talin1 Antibody [NBP1-87820] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human gastrointestinal shows very strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human tonsil shows very strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Talin1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Talin1 Antibody - BSA Free (NBP1-87820) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-Talin1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP
• Predicted Species: Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TLN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation Reported in scientific literature (PMID: 23532850)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Talin1 Protein (NBP1-87820PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Talin1 Antibody - BSA Free

• ILWEQ
• KIAA1027
• talin 1
• Talin1
• talin-1
• TLN
• TLN1

Background

Talin 1 encodes a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. This protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Talin1 Antibody (NBP1-87820)(3)

Publications using NBP1-87820

• Ding L, Wang L, Sui L et al. Claudin-7 indirectly regulates the integrin/FAk signaling pathway in human colon cancer tissue. J. Hum. Genet. 2016-04-28 [PMID: 27121327] (IHC-P, Human)
• Thapa N, Choi S, Hedman A et al. Phosphatidylinositol Phosphate 5-Kinase Igammai2 in Association with Src Controls Anchorage-independent Growth of Tumor Cells. J Biol Chem 2013-11-29 [PMID: 24151076] (WB, Human)
• Philippe M, Leger T, Desvaux R, Walch L. Discs Large 1 (Dlg1) Scaffolding Protein Participates with Clathrin and Adaptator Protein Complex 1 (AP-1) in Forming Weibel-Palade Bodies of Endothelial Cells. J Biol Chem 2013-05-03 [PMID: 23532850] (ICC/IF, IP, WB, Human)

Bioinformatics

• Gene Symbol: TLN1