Talin1 Antibody

Images

 
Orthogonal Strategies: Western Blot: Talin1 Antibody [NBP1-87820] - Analysis in human cell lines U-251MG and MCF-7 using Anti-TLN1 antibody. Corresponding TLN1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: Talin1 Antibody [NBP1-87820] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human gastrointestinal shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Talin1 Antibody [NBP1-87820] - Staining of human tonsil shows very strong cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Talin1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP
Specificity
Specificity of human Talin1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TLN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
Application Notes
IP, WB, ICC/IF reported in scientific literature (PMID: 23532850). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Talin1 Protein (NBP1-87820PEP)
Publications
Read Publications using
NBP1-87820 in the following applications:

  • 1 publication
  • 1 publication
  • IP
    1 publication
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23532850).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Talin1 Antibody

  • ILWEQ
  • KIAA1027
  • talin 1
  • Talin1
  • talin-1
  • TLN
  • TLN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1173
Species: Mu, Rt
Applications: WB, IHC
NBP2-50322
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IP
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, Single-Cell Western
NBP2-45641
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-37448
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-02577
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-14300
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for Talin1 Antibody (NBP1-87820)(3)

Reviews for Talin1 Antibody (NBP1-87820) (0)

There are no reviews for Talin1 Antibody (NBP1-87820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Talin1 Antibody (NBP1-87820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Talin1 Products

Bioinformatics Tool for Talin1 Antibody (NBP1-87820)

Discover related pathways, diseases and genes to Talin1 Antibody (NBP1-87820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Talin1 Antibody (NBP1-87820)

Discover more about diseases related to Talin1 Antibody (NBP1-87820).
 

Pathways for Talin1 Antibody (NBP1-87820)

View related products by pathway.

PTMs for Talin1 Antibody (NBP1-87820)

Learn more about PTMs related to Talin1 Antibody (NBP1-87820).
 

Research Areas for Talin1 Antibody (NBP1-87820)

Find related products by research area.

Blogs on Talin1

There are no specific blogs for Talin1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Talin1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TLN1