TACE/ADAM17 Antibody - BSA Free

Immunohistochemistry-Paraffin: TACE/ADAM17 Antibody [NBP1-86546] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: TACE/ADAM17 Antibody [NBP1-86546] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TACE/ADAM17 Antibody [NBP1-86546] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: TACE/ADAM17 Antibody [NBP1-86546] - Staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cell line U-2 OS shows positivity in cytoplasm.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TACE/ADAM17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TACE/ADAM17 Antibody - BSA Free (NBP1-86546) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TACE/ADAM17 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TACE/ADAM17 Protein (NBP1-86546PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TACE/ADAM17 Antibody - BSA Free

• ADAM 17
• ADAM metallopeptidase domain 17
• ADAM metallopeptidase domain 18
• ADAM17
• ADAM18
• CD156b antigen
• CD156b
• CSVP
• disintegrin and metalloproteinase domain-containing protein 17
• EC 3.4.24.86
• MGC71942
• Snake venom-like protease
• TACE
• TACEcSVP
• TNF-alpha convertase
• TNF-alpha converting enzyme
• TNF-alpha-converting enzyme
• tumor necrosis factor, alpha, converting enzyme

Background

ADAM17 encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TACE/ADAM17 Antibody (NBP1-86546)(1)

Publication using NBP1-86546

• Zhang TC, Zhu WG, Huang MD et al. Prognostic value of ADAM17 in human gastric cancer. Med Oncol 2012-12-01 [PMID: 22139867]

Bioinformatics

• Gene Symbol: ADAM17
• Entrez:
  • 6868(Human)
• Uniprot:
  • P78536()