TACE/ADAM17 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAM17 Antibody [NBP1-86546] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ADAM17 Antibody [NBP1-86546] Staining of human small intestine shows membranous and cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TACE/ADAM17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TACE/ADAM17 Protein (NBP1-86546PEP)
Publications
Read Publication using NBP1-86546.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TACE/ADAM17 Antibody

  • ADAM 17
  • ADAM metallopeptidase domain 17
  • ADAM metallopeptidase domain 18
  • ADAM17
  • ADAM18
  • CD156b antigen
  • CD156b
  • CSVP
  • disintegrin and metalloproteinase domain-containing protein 17
  • EC 3.4.24.86
  • MGC71942
  • Snake venom-like protease
  • TACE
  • TACEcSVP
  • TNF-alpha convertase
  • TNF-alpha converting enzyme
  • TNF-alpha-converting enzyme
  • tumor necrosis factor, alpha, converting enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready

Publications for TACE/ADAM17 Antibody (NBP1-86546)(1)


Reviews for TACE/ADAM17 Antibody (NBP1-86546) (0)

There are no reviews for TACE/ADAM17 Antibody (NBP1-86546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TACE/ADAM17 Antibody (NBP1-86546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TACE/ADAM17 Products

Bioinformatics Tool for TACE/ADAM17 Antibody (NBP1-86546)

Discover related pathways, diseases and genes to TACE/ADAM17 Antibody (NBP1-86546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TACE/ADAM17 Antibody (NBP1-86546)

Discover more about diseases related to TACE/ADAM17 Antibody (NBP1-86546).
 

Pathways for TACE/ADAM17 Antibody (NBP1-86546)

View related products by pathway.

PTMs for TACE/ADAM17 Antibody (NBP1-86546)

Learn more about PTMs related to TACE/ADAM17 Antibody (NBP1-86546).
 

Research Areas for TACE/ADAM17 Antibody (NBP1-86546)

Find related products by research area.

Blogs on TACE/ADAM17

There are no specific blogs for TACE/ADAM17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TACE/ADAM17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM17
Entrez
Uniprot