Syntrophin gamma 2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Syntrophin gamma 2 Antibody - BSA Free (NBP3-21305) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SNTG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Syntrophin gamma 2 Antibody - BSA Free
Background
The Syntrophin gamma 2 gene encodes a protein belonging to the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that bind to components of mechanosenstive sodium channels and the extreme carboxy-terminal domain of dystrophin and dystrophin-relate
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF
Publications for Syntrophin gamma 2 Antibody (NBP3-21305) (0)
There are no publications for Syntrophin gamma 2 Antibody (NBP3-21305).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Syntrophin gamma 2 Antibody (NBP3-21305) (0)
There are no reviews for Syntrophin gamma 2 Antibody (NBP3-21305).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Syntrophin gamma 2 Antibody (NBP3-21305) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Syntrophin gamma 2 Products
Blogs on Syntrophin gamma 2