Synaptoporin Antibody

Images

 
Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-38932] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-38932] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-38932] - Staining in human cerebral cortex and skeletal muscle tissues using anti-SYNPR antibody. Corresponding SYNPR RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptoporin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL
Specificity
Specificity of human Synaptoporin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptoporin Protein (NBP2-38932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptoporin Antibody

  • DKFZp686G0883
  • MGC26651
  • SPO
  • synaptoporin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59340
Species: Hu
Applications: WB, IHC
MAB7357
Species: Hu
Applications: WB

Publications for Synaptoporin Antibody (NBP2-38932) (0)

There are no publications for Synaptoporin Antibody (NBP2-38932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptoporin Antibody (NBP2-38932) (0)

There are no reviews for Synaptoporin Antibody (NBP2-38932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptoporin Antibody (NBP2-38932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Synaptoporin Antibody (NBP2-38932)

Discover related pathways, diseases and genes to Synaptoporin Antibody (NBP2-38932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptoporin Antibody (NBP2-38932)

Discover more about diseases related to Synaptoporin Antibody (NBP2-38932).
 

Pathways for Synaptoporin Antibody (NBP2-38932)

View related products by pathway.

PTMs for Synaptoporin Antibody (NBP2-38932)

Learn more about PTMs related to Synaptoporin Antibody (NBP2-38932).

Blogs on Synaptoporin

There are no specific blogs for Synaptoporin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptoporin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNPR
Uniprot