SYPL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SYPL1 Antibody [NBP1-80708] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SYPL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SYPL1 Antibody - BSA Free (NBP1-80708) is a polyclonal antibody validated for use in IHC and WB. Anti-SYPL1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATGHNIIDELPPCKKKAVLCYFGSVTSMGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: HIER pH6 retrieval is recommended.
• Control Peptide:

  SYPL1 Protein (NBP1-80708PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SYPL1 Antibody - BSA Free

• H-SP1
• pantophysin
• synaptophysin-like 1
• synaptophysin-like protein 1
• synaptophysin-like protein
• SYPL

Background

SYPL1 is a gene that codes for a protein that has two isoforms, with lengths of 259 and 241 amino acids and weights of approximately 29 and 26 kDa respectively. Current research is being done on diseases and disorders related to this gene including neruonitis and alcoholism. SYPL1 has also been shown to have interactions with VAMP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SYPL1 Antibody (NBP1-80708)(2)

Publications using NBP1-80708

• Kim D, Khin PP, Lim OK, Jun HS LPA/LPAR1 signaling induces PGAM1 expression via AKT/mTOR/HIF-1 alpha pathway and increases aerobic glycolysis, contributing to keratinocyte proliferation Life sciences 2022-12-15 [PMID: 36400203] (IHC-P, WB, Mouse, Human)
• Sheth VG, Sharma N, Kabeer SW, Tikoo K Lactobacillus rhamnosus supplementation ameliorates high fat diet-induced epigenetic alterations and prevents its intergenerational inheritance Life sciences 2022-12-15 [PMID: 36343744] (WB, Rat)

Bioinformatics

• Gene Symbol: SYPL1
• Entrez:
  • 6856(Human)
• Uniprot:
  • Q16563(Human)