Synaptoporin Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-13405] - Staining of human colon, hippocampus, kidney and liver using Anti-SYNPR antibody NBP2-13405 (A) shows similar protein distribution across tissues to independent antibody NBP2-38932 (B).

Western Blot: Synaptoporin Antibody [NBP2-13405] - Analysis in control (vector only transfected HEK293T lysate) and SYNPR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-13405] - Staining of human kidney.

Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-13405] - Staining of human liver.

Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-13405] - Staining of human colon.

Immunohistochemistry-Paraffin: Synaptoporin Antibody [NBP2-13405] - Staining of human hippocampus.

Analysis in control (vector only transfected HEK293T lysate) and SYNPR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Synaptoporin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNPR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Synaptoporin Protein (NBP2-13405PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Synaptoporin Antibody - BSA Free

• DKFZp686G0883
• MGC26651
• SPO
• synaptoporin

Background

SYNPR( Synaptoporin) is a component of the synaptic vesicle membrane and thought to play an important role in synaptic vesicle trafficking. It is highly homologous to Synaptophysin 1 yet it differs in expression. Synaptophysin 1 is ubiquitiously expressed, SYNPR is concentrated in the mossy fibre synapses of the hippocampus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNPR