Synaptic glycoprotein SC2 Antibody - BSA Free

Western Blot: Synaptic glycoprotein SC2 Antibody [NBP1-60088] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: Synaptic glycoprotein SC2 Antibody [NBP1-60088] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Synaptic glycoprotein SC2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TECR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Synaptic glycoprotein SC2 Antibody - BSA Free

• EC 1.3.1
• EC 1.3.1.38
• glycoprotein, synaptic 2
• GPSN2
• Synaptic glycoprotein SC2
• TERSC2
• trans-2,3-enoyl-CoA reductase

Background

Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. TER catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA (Moon and Horton, 2003 [PubMed 12482854]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-680 BG705196.1 7-686 681-1197 BC013881.2 632-1148

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TECR
• Uniprot:
  • Q9NZ01(Human)