Surfactant Protein A Antibody - BSA Free

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46720] - Staining of human lung shows strong cytoplasmic and membranous positivity in pneumocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Surfactant Protein A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Surfactant Protein A Recombinant Protein Antigen (NBP2-46720PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Surfactant Protein A Antibody - BSA Free

• COLEC4
• PSAP
• PSPA
• PSP-A
• SFTP1
• SFTPA1
• SFTPA1B
• SPA
• SP-A
• SPA1
• SP-A1
• surfactant protein A1B

Background

Surfactant protein A is a protein with two isoforms, with lengths of 248 and 263 amino acids and weights of approximately 26 and 28 kDa respectively. Surfactant protein A binds to surfactant phospholipids in the presence of calcium ions and helps lower the surface tension in the alveoli of the lungs. Current research is being done on several diseases and disorders linked to this protein including pulmonary fibrosis, allergic bronchopulmonary aspergillosis, pulmonary alveolar proteinosis, non-small cell lung carcinoma, sclerosing hemangioma, otitis media, chronic obstructive pulmonary disease, bronchitis obliterans, bronchopulmonary dysplasia, rhinitis, aspergillosis, pulmonary edema, insulin resistance, and pneumoconiosis. Surfactant protein A has also been shown to have interactions with DMBT1, MYO18A, C1QA, SFTPD, and TLR2 in pathways such as the immune response, bacterial infections in CF airways, cell-cell communication, phagosome, and pertussis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFTPA1
• Entrez:
  • 729238(Human)
• Uniprot:
  • Q8IWL1(Human)