Sulfatase Modifying Factor 1/SUMF1 Antibody


Western Blot: Sulfatase Modifying Factor 1/SUMF1 Antibody [NBP1-83905] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Sulfatase Modifying Factor 1/SUMF1 Antibody [NBP1-83905] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Western Blot: Sulfatase Modifying Factor 1/SUMF1 Antibody [NBP1-83905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Sulfatase Modifying Factor 1/SUMF1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
Specificity of human, mouse, rat Sulfatase Modifying Factor 1/SUMF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Sulfatase Modifying Factor 1/SUMF1 Antibody

  • AAPA3037
  • EC 1.8.99.-
  • FGE1
  • FGEC-alpha-formylglycine-generating enzyme 1
  • FGly-generating enzyme
  • MGC131853
  • MGC150436
  • sulfatase modifying factor 1
  • sulfatase-modifying factor 1
  • SUMF1
  • UNQ3037


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905) (0)

There are no publications for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905) (0)

There are no reviews for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Sulfatase Modifying Factor 1/SUMF1 Products

Bioinformatics Tool for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905)

Discover related pathways, diseases and genes to Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905)

Discover more about diseases related to Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905).

Pathways for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905)

View related products by pathway.

PTMs for Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905)

Learn more about PTMs related to Sulfatase Modifying Factor 1/SUMF1 Antibody (NBP1-83905).

Blogs on Sulfatase Modifying Factor 1/SUMF1

There are no specific blogs for Sulfatase Modifying Factor 1/SUMF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sulfatase Modifying Factor 1/SUMF1 Antibody and receive a gift card or discount.


Gene Symbol SUMF1