ARSJ Antibody


Western Blot: ARSJ Antibody [NBP2-48658] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasma
Immunocytochemistry/ Immunofluorescence: ARSJ Antibody [NBP2-48658] - Staining of human cell line BJ shows localization to actin filaments.
Immunohistochemistry: ARSJ Antibody [NBP2-48658] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ARSJ Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARSJ Recombinant Protein Antigen (NBP2-48658PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARSJ Antibody

  • arylsulfatase family, member J
  • arylsulfatase J
  • ASJ
  • EC 3.1.6
  • EC 3.1.6.-
  • EC
  • FLJ23548


Sulfatases (EC, such as ARSJ, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for ARSJ Antibody (NBP2-48658) (0)

There are no publications for ARSJ Antibody (NBP2-48658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARSJ Antibody (NBP2-48658) (0)

There are no reviews for ARSJ Antibody (NBP2-48658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARSJ Antibody (NBP2-48658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARSJ Products

Bioinformatics Tool for ARSJ Antibody (NBP2-48658)

Discover related pathways, diseases and genes to ARSJ Antibody (NBP2-48658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARSJ Antibody (NBP2-48658)

Discover more about diseases related to ARSJ Antibody (NBP2-48658).

Research Areas for ARSJ Antibody (NBP2-48658)

Find related products by research area.

Blogs on ARSJ

There are no specific blogs for ARSJ, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARSJ Antibody and receive a gift card or discount.


Gene Symbol ARSJ