Sulfatase 1 Antibody

Images

 
Western Blot: Sulfatase 1 Antibody [NBP2-31584] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Sulfatase 1 Antibody [NBP2-31584] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sulfatase 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sulfatase 1 Protein (NBP2-31584PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sulfatase 1 Antibody

  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.14
  • extracellular sulfatase Sulf-1
  • FLJ30905
  • FLJ38022
  • FLJ41750
  • hSulf-1
  • KIAA1077sulfatase FP
  • SULF-1
  • sulfatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00347527-B01P
Species: Hu
Applications: WB, ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5057
Species: Hu
Applications: WB
259-HE
Species: Hu
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for Sulfatase 1 Antibody (NBP2-31584) (0)

There are no publications for Sulfatase 1 Antibody (NBP2-31584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase 1 Antibody (NBP2-31584) (0)

There are no reviews for Sulfatase 1 Antibody (NBP2-31584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase 1 Antibody (NBP2-31584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sulfatase 1 Products

Bioinformatics Tool for Sulfatase 1 Antibody (NBP2-31584)

Discover related pathways, diseases and genes to Sulfatase 1 Antibody (NBP2-31584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase 1 Antibody (NBP2-31584)

Discover more about diseases related to Sulfatase 1 Antibody (NBP2-31584).
 

Pathways for Sulfatase 1 Antibody (NBP2-31584)

View related products by pathway.

PTMs for Sulfatase 1 Antibody (NBP2-31584)

Learn more about PTMs related to Sulfatase 1 Antibody (NBP2-31584).
 

Research Areas for Sulfatase 1 Antibody (NBP2-31584)

Find related products by research area.

Blogs on Sulfatase 1

There are no specific blogs for Sulfatase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sulfatase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULF1
Uniprot