Sulfatase 1 Antibody - BSA Free

Western Blot: Sulfatase 1 Antibody [NBP2-31584] - Analysis in human cell line U-138MG.

Immunohistochemistry-Paraffin: Sulfatase 1 Antibody [NBP2-31584] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Sulfatase 1 Antibody [NBP2-31584] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Sulfatase 1 Antibody [NBP2-31584] - Staining of human endometrium shows weak cytoplasmic positivity in stromal cells.

Immunohistochemistry-Paraffin: Sulfatase 1 Antibody [NBP2-31584] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sulfatase 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SULF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sulfatase 1 Protein (NBP2-31584PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sulfatase 1 Antibody - BSA Free

• EC 3.1.6
• EC 3.1.6.-
• EC 3.1.6.14
• extracellular sulfatase Sulf-1
• FLJ30905
• FLJ38022
• FLJ41750
• hSulf-1
• KIAA1077sulfatase FP
• SULF-1
• sulfatase 1

Background

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sulfatase 1 Antibody (NBP2-31584)(1)

Publication using NBP2-31584

• Manouchehri J, Datta J, Marcho L et al. Sulfatase 2 inhibition sensitizes triple-negative breast cancer cells to paclitaxel through augmentation of extracellular ATP Cancer Biology & Therapy 2025-03-26 [PMID: 40140347]

Bioinformatics

• Gene Symbol: SULF1
• Uniprot:
  • Q8IWU6(Human)