STEAP1 Antibody (4F6-1F3) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse STEAP1 Antibody (4F6-1F3) - Azide and BSA Free (H00026872-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL |
| Specificity |
STEAP1 - six transmembrane epithelial antigen of the prostate 1 (4F6-1F3) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
STEAP1 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:2000
- Western Blot 1:500
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for STEAP1 Antibody (4F6-1F3) - Azide and BSA Free
Background
This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, PA, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for STEAP1 Antibody (H00026872-M01) (0)
There are no publications for STEAP1 Antibody (H00026872-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STEAP1 Antibody (H00026872-M01) (0)
There are no reviews for STEAP1 Antibody (H00026872-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STEAP1 Antibody (H00026872-M01). (Showing 1 - 1 of 1 FAQ).
-
May any of your anti human-STEAP1 Abs be used for flow cytometry, with a secondary anti-mouse antibody? E.g. J2D2 or 4F6-1F3?
- Unfortunately, none of our STEAP1 antibodies have been validated in flow cytometry yet. This does not mean they will not work in FLOW, we just cannot guarantee its use in FLOW application because we have not tested them in this application in our lab yet. However, if you would like to try one of these antibodies in FLOW, you would be eligible for our Innovator's Reward program, whereby if you share your results with us, we will reward you with a voucher for 100% of the purchase price. Technically, STEAP1 (J2D2) NBP1-07094 and STEAP1 (4F6-1F3) H00026872-M01 are the two antibodies that have more chances of success because of proven compatibility with IF labeled secondary antibodies as they have already been validated in ICC-IF.
Secondary Antibodies
| |
Isotype Controls
|
Additional STEAP1 Products
Research Areas for STEAP1 Antibody (H00026872-M01)
Find related products by research area.
|
Blogs on STEAP1