STEAP2 Antibody - BSA Free Summary
Immunogen |
Antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human STEAP2. The immunogen is located within the last 50 amino acids of STEAP2. Amino Acid Squence: KLKRIKKGWEKSQFLE |
Specificity |
This STEAP2 antibody does not cross-react with other STEAP proteins. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
STEAP2 |
Purity |
Peptide affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:100-1:2000
- Immunofluorescence 20 ug/ml
- Immunohistochemistry 2.5 ug/ml
- Immunohistochemistry-Paraffin 2.5 ug/ml
- Western Blot 1-2 ug/ml
|
Theoretical MW |
55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS |
Preservative |
0.02% Sodium Azide |
Concentration |
1 mg/ml |
Purity |
Peptide affinity purified |
Alternate Names for STEAP2 Antibody - BSA Free
Background
The six-transmembrane epithelial antigen of prostate 2 (STEAP2) is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. Similar to two other members of the STEAP family (STEAP 3 and STEAP4), STEAP2 promotes both iron and copper reduction. STEAP2 expression in transfected cells also correlated with iron or copper uptake, suggesting that the STEAP family of proteins may function to stimulate iron and copper uptake. STEAP2 is widely expressed in many tissues in the plasma membrane, but is most highly expressed in prostate. At least three isoforms of STEAP2 are known to exist. This STEAP2 antibody does not cross-react with other STEAP proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, ICC/IF
Publications for STEAP2 Antibody (NBP1-76823) (0)
There are no publications for STEAP2 Antibody (NBP1-76823).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STEAP2 Antibody (NBP1-76823) (0)
There are no reviews for STEAP2 Antibody (NBP1-76823).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STEAP2 Antibody (NBP1-76823). (Showing 1 - 1 of 1 FAQ).
-
I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
- We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
Secondary Antibodies
| |
Isotype Controls
|
Additional STEAP2 Products
Bioinformatics Tool for STEAP2 Antibody (NBP1-76823)
Discover related pathways, diseases and genes to STEAP2 Antibody (NBP1-76823). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for STEAP2 Antibody (NBP1-76823)
Discover more about diseases related to STEAP2 Antibody (NBP1-76823).
| | Pathways for STEAP2 Antibody (NBP1-76823)
View related products by pathway.
|
Blogs on STEAP2