STEAP2 Antibody - BSA Free

Images

 
Western Blot: STEAP2 Antibody [NBP1-76823] - Analysis in human prostate tissue lysate with antibody at 1 ug/mL.
Immunohistochemistry-Paraffin: STEAP2 Antibody [NBP1-76823] - Human colon tissue with STEAP2 antibody at 2.5 ug/ml.
Immunofluorescence: STEAP2 Antibody [NBP1-76823] - Immunofluorescence of STEAP2 in Human Colon cells with STEAP2 antibody at 20 ug/mL.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
1 mg/ml

Order Details

View Available Formulations
Catalog# & Formulation Size Price

STEAP2 Antibody - BSA Free Summary

Immunogen
Antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human STEAP2. The immunogen is located within the last 50 amino acids of STEAP2. Amino Acid Squence: KLKRIKKGWEKSQFLE
Specificity
This STEAP2 antibody does not cross-react with other STEAP proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STEAP2
Purity
Peptide affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunofluorescence 20 ug/ml
  • Immunohistochemistry 2.5 ug/ml
  • Immunohistochemistry-Paraffin 2.5 ug/ml
  • Western Blot 1-2 ug/ml
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
STEAP2 Peptide (NBP1-76823PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.02% Sodium Azide
Concentration
1 mg/ml
Purity
Peptide affinity purified

Alternate Names for STEAP2 Antibody - BSA Free

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Background

The six-transmembrane epithelial antigen of prostate 2 (STEAP2) is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. Similar to two other members of the STEAP family (STEAP 3 and STEAP4), STEAP2 promotes both iron and copper reduction. STEAP2 expression in transfected cells also correlated with iron or copper uptake, suggesting that the STEAP family of proteins may function to stimulate iron and copper uptake. STEAP2 is widely expressed in many tissues in the plasma membrane, but is most highly expressed in prostate. At least three isoforms of STEAP2 are known to exist. This STEAP2 antibody does not cross-react with other STEAP proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5587
Species: Hu
Applications: Simple Western, WB
NB100-68162
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NBP1-76824
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
5829-ST
Species: Hu
Applications: EnzAct
NBP3-04803
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
375-TL
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
AF7109
Species: Mu
Applications: IHC, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-76823
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, ICC/IF

Publications for STEAP2 Antibody (NBP1-76823) (0)

There are no publications for STEAP2 Antibody (NBP1-76823).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Antibody (NBP1-76823) (0)

There are no reviews for STEAP2 Antibody (NBP1-76823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STEAP2 Antibody (NBP1-76823). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Secondary Antibodies

 

Isotype Controls

Additional STEAP2 Products

Bioinformatics Tool for STEAP2 Antibody (NBP1-76823)

Discover related pathways, diseases and genes to STEAP2 Antibody (NBP1-76823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP2 Antibody (NBP1-76823)

Discover more about diseases related to STEAP2 Antibody (NBP1-76823).
 

Pathways for STEAP2 Antibody (NBP1-76823)

View related products by pathway.

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STEAP2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP2
Uniprot