STEAP3/TSAP6 Antibody

Images

 
Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
Immunocytochemistry/ Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STEAP3/TSAP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKI LVDVSNPTEQEHLQHRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STEAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STEAP3/TSAP6 Protein (NBP2-13395PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STEAP3/TSAP6 Antibody

  • AHMIO2
  • dudlin 2
  • Dudlin-2
  • dudulin 2
  • dudulin-2
  • Dudulin-2,1010001D01Rik
  • EC 1.16.1.-
  • hpHyde
  • hTSAP6
  • metalloreductase STEAP3
  • pHyde
  • six transmembrane prostate protein 3
  • Six-transmembrane epithelial antigen of prostate 3
  • STEAP family member 3
  • STEAP3
  • STMP3
  • TSAP6
  • TSAP6STMP3
  • tumor suppressor pHyde
  • Tumor suppressor-activated pathway protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76822
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-76823
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-78264
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-80831
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-85092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15888
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13395
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STEAP3/TSAP6 Antibody (NBP2-13395) (0)

There are no publications for STEAP3/TSAP6 Antibody (NBP2-13395).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP3/TSAP6 Antibody (NBP2-13395) (0)

There are no reviews for STEAP3/TSAP6 Antibody (NBP2-13395). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STEAP3/TSAP6 Antibody (NBP2-13395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STEAP3/TSAP6 Products

Bioinformatics Tool for STEAP3/TSAP6 Antibody (NBP2-13395)

Discover related pathways, diseases and genes to STEAP3/TSAP6 Antibody (NBP2-13395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP3/TSAP6 Antibody (NBP2-13395)

Discover more about diseases related to STEAP3/TSAP6 Antibody (NBP2-13395).
 

Pathways for STEAP3/TSAP6 Antibody (NBP2-13395)

View related products by pathway.

PTMs for STEAP3/TSAP6 Antibody (NBP2-13395)

Learn more about PTMs related to STEAP3/TSAP6 Antibody (NBP2-13395).

Blogs on STEAP3/TSAP6

There are no specific blogs for STEAP3/TSAP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STEAP3/TSAP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP3
Entrez