PSCA Antibody (5C2)


Western Blot: PSCA Antibody (5C2) [H00008000-M03] - Analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M03), clone 5C2. Lane 1: PSCA transfected lysatE (12.9 KDa). Lane 2: more
ELISA: PSCA Antibody (5C2) [H00008000-M03] - Detection limit for recombinant GST tagged PSCA is 0.1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

PSCA Antibody (5C2) Summary

PSCA (NP_005663, 23 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Cell membrane; Lipid-anchor, GPI-anchor.
Prostate Stem Cell Marker
PSCA - prostate stem cell antigen
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Positive Control
PSCA Lysate (NBP2-64827)

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSCA Antibody (5C2)

  • PRO232
  • prostate stem cell antigen
  • PSCA


This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for PSCA Antibody (H00008000-M03) (0)

There are no publications for PSCA Antibody (H00008000-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSCA Antibody (H00008000-M03) (0)

There are no reviews for PSCA Antibody (H00008000-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSCA Antibody (H00008000-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PSCA Products

Bioinformatics Tool for PSCA Antibody (H00008000-M03)

Discover related pathways, diseases and genes to PSCA Antibody (H00008000-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSCA Antibody (H00008000-M03)

Discover more about diseases related to PSCA Antibody (H00008000-M03).

Pathways for PSCA Antibody (H00008000-M03)

View related products by pathway.

PTMs for PSCA Antibody (H00008000-M03)

Learn more about PTMs related to PSCA Antibody (H00008000-M03).

Research Areas for PSCA Antibody (H00008000-M03)

Find related products by research area.

Blogs on PSCA

There are no specific blogs for PSCA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PSCA Antibody (5C2) and receive a gift card or discount.


Gene Symbol PSCA