STAT5b Antibody (6P5T0)

Western Blot: STAT5b Antibody (6P5T0) [NBP3-15778] - Western blot analysis of extracts of various cell lines, using STAT5b antibody (NBP3-15778) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: STAT5b Antibody (6P5T0) [NBP3-15778] - Western blot analysis of extracts from normal (control) and STAT5b knockout (KO) HeLa cells, using STAT5b antibody (NBP3-15778) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: STAT5b Antibody (6P5T0) [NBP3-15778] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug STAT5b antibody (NBP3-15778). Western blot was performed from the immunoprecipitate using STAT5b antibody (NBP3-15778) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP, KO
• Clone: 6P5T0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

STAT5b Antibody (6P5T0) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit STAT5b Antibody (6P5T0) (NBP3-15778) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692). KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STAT5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STAT5b Antibody (6P5T0)

• signal transducer and activator of transcription 5B
• STAT5
• STAT5b
• transcription factor STAT5B

Background

STAT5B is encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAT5B