STAT4 Antibody

Images

 
Western Blot: STAT4 Antibody [NBP1-89474] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: STAT4 Antibody [NBP1-89474] - Staining of human testis shows moderate nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STAT4 Protein (NBP1-89474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAT4 Antibody

  • signal transducer and activator of transcription 4
  • SLEB11
  • STAT4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
NBP1-89474
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for STAT4 Antibody (NBP1-89474) (0)

There are no publications for STAT4 Antibody (NBP1-89474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT4 Antibody (NBP1-89474) (0)

There are no reviews for STAT4 Antibody (NBP1-89474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAT4 Antibody (NBP1-89474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT4 Products

Bioinformatics Tool for STAT4 Antibody (NBP1-89474)

Discover related pathways, diseases and genes to STAT4 Antibody (NBP1-89474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT4 Antibody (NBP1-89474)

Discover more about diseases related to STAT4 Antibody (NBP1-89474).
 

Pathways for STAT4 Antibody (NBP1-89474)

View related products by pathway.

PTMs for STAT4 Antibody (NBP1-89474)

Learn more about PTMs related to STAT4 Antibody (NBP1-89474).

Blogs on STAT4

There are no specific blogs for STAT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT4
Entrez