STAG2 Antibody

Images

 
Immunohistochemistry-Paraffin: STAG2 Antibody [NBP1-87096] - Staining of human lymph node shows moderate nuclear positivity in reaction center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STAG2 Protein (NBP1-87096PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAG2 Antibody

  • bA517O1.1
  • cohesin subunit SA-2
  • DKFZp686P168
  • SA-2
  • SA2FLJ25871
  • SCC3 homolog 2
  • stromal antigen 2DKFZp781H1753

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-298
Species: Hu, Xp
Applications: WB, ICC/IF, PLA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00056937-M01
Species: Hu
Applications: WB, ELISA
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for STAG2 Antibody (NBP1-87096) (0)

There are no publications for STAG2 Antibody (NBP1-87096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAG2 Antibody (NBP1-87096) (0)

There are no reviews for STAG2 Antibody (NBP1-87096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STAG2 Antibody (NBP1-87096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAG2 Products

Bioinformatics Tool for STAG2 Antibody (NBP1-87096)

Discover related pathways, diseases and genes to STAG2 Antibody (NBP1-87096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAG2 Antibody (NBP1-87096)

Discover more about diseases related to STAG2 Antibody (NBP1-87096).
 

Pathways for STAG2 Antibody (NBP1-87096)

View related products by pathway.

PTMs for STAG2 Antibody (NBP1-87096)

Learn more about PTMs related to STAG2 Antibody (NBP1-87096).
 

Research Areas for STAG2 Antibody (NBP1-87096)

Find related products by research area.

Blogs on STAG2

There are no specific blogs for STAG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAG2