TMEPAI Antibody (2A12)

Images

 
ELISA: TMEPAI Antibody (2A12) [H00056937-M01] - Detection limit for recombinant GST tagged TMEPAI is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TMEPAI Antibody (2A12) Summary

Immunogen
TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Localization
Cell Membrane
Specificity
TMEPAI - transmembrane, prostate androgen induced RNA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PMEPA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00056937-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEPAI Antibody (2A12)

  • prostate transmembrane protein, androgen induced 1
  • Solid tumor-associated 1 protein
  • STAG1prostate androgen induced RNA
  • transmembrane prostate androgen-induced protein

Background

Interacts with the WW domains of NEDD4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010735-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, S-ELISA
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ELISA, ICC
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P

Publications for TMEPAI Antibody (H00056937-M01)(10)

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 10.
Publications using H00056937-M01 Applications Species
Kumar P, Sharad S, Petrovics G et al. Loss of miR-449a in ERG-associated prostate cancer promotes the invasive phenotype by inducing SIRT1. Oncotarget 2016 Apr 19 [PMID: 26988912] (WB) WB
Li H, Mohamed AA, Sharad S et al. Silencing of PMEPA1 accelerates the growth of prostate cancer cells through AR, NEDD4 and PTEN. Oncotarget 2015 Jun 20 [PMID: 25883222] (WB) WB
Singha PK, Pandeswara S, Geng H et al. TGF-b induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer. Genes Cancer. 2014 Sep 01 [PMID: 25352949]
O Hainmhire E, Quartuccio SM, Cheng W et al. Mutation or Loss of p53 Differentially Modifies TGFb Action in Ovarian Cancer PLoS One. 2014 Feb 20 [PMID: 24586866]
Hu Y, He K, Wang D et al. TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways. Carcinogenesis. 2013 Apr 24 [PMID: 23615405]
Costea DE, Hills A, Osman AH et al. Identification of two distinct carcinoma-associated fibroblast subtypes with differential tumor-promoting abilities in oral squamous cell carcinoma. Cancer Res. 2013 Apr 18 [PMID: 23598279]
Singha PK, Yeh IT, Venkatachalam MA et al. Transforming Growth Factor-{beta} (TGF-{beta})-Inducible Gene TMEPAI Converts TGF-{beta} from a Tumor Suppressor to a Tumor Promoter in Breast Cancer. Cancer Res. 2010 Jul 7. [PMID: 20610632]
Watanabe Y, Itoh S, Goto T et al. TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling. Mol Cell 37(1):123-34. 2010 Jan 15. [PMID: 20129061]
Li H, Xu LL, Masuda K et al. A feedback loop between the rogen receptor a NEDD4 binding protein, PMEPA1 in prostate cancer cells. J Biol Chem;283(43):28988-95. 2008 Oct 24. [PMID: 18703514]
Hirokawa YS, Takagi A, Uchida K et al. High level expression of STAG1/PMEPA1 in an rogen-independent prostate cancer PC3 subclone. Cell Mol Biol Lett. 2007 Feb 17. [PMID: 17318295]

Reviews for TMEPAI Antibody (H00056937-M01) (0)

There are no reviews for TMEPAI Antibody (H00056937-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEPAI Antibody (H00056937-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEPAI Products

Bioinformatics Tool for TMEPAI Antibody (H00056937-M01)

Discover related pathways, diseases and genes to TMEPAI Antibody (H00056937-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEPAI Antibody (H00056937-M01)

Discover more about diseases related to TMEPAI Antibody (H00056937-M01).
 

Pathways for TMEPAI Antibody (H00056937-M01)

View related products by pathway.

PTMs for TMEPAI Antibody (H00056937-M01)

Learn more about PTMs related to TMEPAI Antibody (H00056937-M01).
 

Research Areas for TMEPAI Antibody (H00056937-M01)

Find related products by research area.

Blogs on TMEPAI

There are no specific blogs for TMEPAI, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEPAI Antibody (2A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PMEPA1
Entrez
OMIM
Uniprot