Stabilin-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Stabilin-2 Antibody [NBP1-84197] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Stabilin-2 Antibody [NBP1-84197] - Staining of human spleen shows distinct positivity in sinusoid endothelium.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Stabilin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Stabilin-2 Protein (NBP1-84197PEP)
Publications
Read Publication using NBP1-84197.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Stabilin-2 Antibody

  • CD44-like precursor FELL
  • DKFZP434E0321
  • FAS1 EGF-like and X-link domain containing adhesion molecule-2
  • FAS1 EGF-like and X-link domain-containing adhesion molecule 2
  • fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-2
  • Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 2
  • FEEL2
  • FEEL-2
  • FELE-2
  • FELL
  • FELL-2
  • FEX2
  • HARE
  • HAREFELL2
  • hepatic hyaluronan clearance receptor
  • Hyaluronan receptor for endocytosis
  • hyaluronic acid receptor for endocytosis
  • STAB2
  • STAB-2
  • stabilin 2
  • Stabilin2
  • Stabilin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3825
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2125
Species: Mu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC

Publications for Stabilin-2 Antibody (NBP1-84197)(1)

Reviews for Stabilin-2 Antibody (NBP1-84197) (0)

There are no reviews for Stabilin-2 Antibody (NBP1-84197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Stabilin-2 Antibody (NBP1-84197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Stabilin-2 Products

Bioinformatics Tool for Stabilin-2 Antibody (NBP1-84197)

Discover related pathways, diseases and genes to Stabilin-2 Antibody (NBP1-84197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stabilin-2 Antibody (NBP1-84197)

Discover more about diseases related to Stabilin-2 Antibody (NBP1-84197).
 

Pathways for Stabilin-2 Antibody (NBP1-84197)

View related products by pathway.

PTMs for Stabilin-2 Antibody (NBP1-84197)

Learn more about PTMs related to Stabilin-2 Antibody (NBP1-84197).

Blogs on Stabilin-2

There are no specific blogs for Stabilin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stabilin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAB2
Entrez
Uniprot