GULP1/CED-6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GULP1/CED-6 Antibody [NBP1-84553] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Staining of human lymph node shows no cytoplasmic positivity in non-germinal center cells as expected.

Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Analysis in human placenta and lymph node tissues using HPA020587 antibody. Corresponding GULP1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GULP1/CED-6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GULP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GULP1/CED-6 Protein (NBP1-84553PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GULP1/CED-6 Antibody - BSA Free

• CED6
• CED6GULPCED-6
• Cell death protein 6 homolog
• engulfment adapter protein
• FLJ31156
• GULP, engulfment adaptor PTB domain containing 1
• GULP1
• Protein GULP
• PTB domain adapter protein CED-6
• PTB domain adaptor protein CED-6
• PTB domain-containing engulfment adapter protein 1

Background

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, as well as inflammation and autoimmunity. CED6 and its human homologue gulp, encode an adapter protein, whose function in engulfment. The upstream and downstream components of CED6 mediated signaling are not known. Recently, CED1 has been shown to encode a transmembrane protein on phagocytic cells, with two functional sequence motifs in its cytoplasmic tail that are important for engulfment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GULP1/CED-6 Antibody (NBP1-84553)(2)

Publications using NBP1-84553

• Maldonado L, Brait M, Izumchenko E et al. Integrated transcriptomic and epigenomic analysis of ovarian cancer reveals epigenetically silenced GULP1. Cancer Lett. 2018-10-01 [PMID: 29964205] (WB, Human)
• Morizawa YM, Hirayama Y, Ohno N et al. Reactive astrocytes function as phagocytes after brain ischemia via ABCA1-mediated pathway Nat Commun 2017-06-22 [PMID: 28642575]

FAQs for GULP1/CED-6 Antibody (NBP1-84553). (Showing 1 - 1 of 1 FAQs).

1. Is GULP1 localized to mitochondria?
   • I am showing based on localization data from UniProt that it may associate with the cytoplasmic side of the plasma membrane: http://www.uniprot.org/uniprot/Q9UBP9 Additional localization data may be found here at Human protein atlas: http://www.proteinatlas.org/ENSG00000144366

Bioinformatics

• Gene Symbol: GULP1