GULP1/CED-6 Antibody

Images

 
Western Blot: GULP1/CED-6 Antibody [NBP1-84553] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: GULP1/CED-6 Antibody [NBP1-84553] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: GULP1/CED-6 Antibody [NBP1-84553] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GULP1/CED-6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GULP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GULP1/CED-6 Protein (NBP1-84553PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GULP1/CED-6 Antibody

  • CED6
  • CED6GULPCED-6
  • Cell death protein 6 homolog
  • engulfment adapter protein
  • FLJ31156
  • GULP, engulfment adaptor PTB domain containing 1
  • GULP1
  • Protein GULP
  • PTB domain adapter protein CED-6
  • PTB domain adaptor protein CED-6
  • PTB domain-containing engulfment adapter protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
42080002
Species: Ce
Applications: ELISA
NB100-875
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
NB100-873
Species: Hu
Applications: WB, IHC, PEP-ELISA
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF7070
Species: Hu, Rt
Applications: WB
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
AF3645
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GULP1/CED-6 Antibody (NBP1-84553) (0)

There are no publications for GULP1/CED-6 Antibody (NBP1-84553).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GULP1/CED-6 Antibody (NBP1-84553) (0)

There are no reviews for GULP1/CED-6 Antibody (NBP1-84553). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GULP1/CED-6 Antibody (NBP1-84553). (Showing 1 - 1 of 1 FAQ).

  1. Is GULP1 localized to mitochondria?
    • I am showing based on localization data from UniProt that it may associate with the cytoplasmic side of the plasma membrane: http://www.uniprot.org/uniprot/Q9UBP9 Additional localization data may be found here at Human protein atlas: http://www.proteinatlas.org/ENSG00000144366

Secondary Antibodies

 

Isotype Controls

Additional GULP1/CED-6 Products

Bioinformatics Tool for GULP1/CED-6 Antibody (NBP1-84553)

Discover related pathways, diseases and genes to GULP1/CED-6 Antibody (NBP1-84553). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GULP1/CED-6 Antibody (NBP1-84553)

Discover more about diseases related to GULP1/CED-6 Antibody (NBP1-84553).
 

Pathways for GULP1/CED-6 Antibody (NBP1-84553)

View related products by pathway.

PTMs for GULP1/CED-6 Antibody (NBP1-84553)

Learn more about PTMs related to GULP1/CED-6 Antibody (NBP1-84553).
 

Research Areas for GULP1/CED-6 Antibody (NBP1-84553)

Find related products by research area.

Blogs on GULP1/CED-6

There are no specific blogs for GULP1/CED-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GULP1/CED-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GULP1
Entrez