SSBP2 Antibody - BSA Free

Immunohistochemistry: SSBP2 Antibody [NBP3-10915] - Immunohistochemical analysis of myenteric plexus of the colon

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SSBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SSBP2 Antibody - BSA Free (NBP3-10915) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2 (NP_036578). Peptide sequence YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SSBP2 Antibody - BSA Free

• DKFZp686F03273
• HSPC116
• Sequence-specific single-stranded-DNA-binding protein 2
• single-stranded DNA binding protein 2
• single-stranded DNA-binding protein 2
• SOSS-B2
• SSDP2

Background

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSBP2