SSBP2 Antibody - Azide and BSA Free

Western Blot: SSBP2 Antibody [H00023635-B01P] - Analysis of SSBP2 expression in transfected 293T cell line by SSBP2 polyclonal antibody. Lane1:SSBP2 transfected lysate(39.82 KDa). Lane 2:Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SSBP2 Antibody [H00023635-B01P] - Analysis of purified antibody to SSBP2 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SSBP2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SSBP2 Antibody - Azide and BSA Free (H00023635-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SSBP2 (AAH17020, 1 a.a. - 361 a.a.) full-length human protein. MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV
• Specificity: SSBP2 - single-stranded DNA binding protein 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SSBP2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSBP2 Antibody - Azide and BSA Free

• DKFZp686F03273
• HSPC116
• Sequence-specific single-stranded-DNA-binding protein 2
• single-stranded DNA binding protein 2
• single-stranded DNA-binding protein 2
• SOSS-B2
• SSDP2

Background

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSBP2
• Entrez:
  • 23635(Human)
• Uniprot:
  • AAH17020(Human)