SRD5A1 Antibody - Azide and BSA Free

Western Blot: SRD5A1 Antibody - Azide and BSA Free [NBP2-93860] - Western blot analysis of lysates from Mouse skin, using SRD5A1 Rabbit pAb (A14787) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SRD5A1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SRD5A1 Antibody - Azide and BSA Free (NBP2-93860) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRD5A1 (NP_001038.1). LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRD5A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SRD5A1 Antibody - Azide and BSA Free

• 3-oxo-5-alpha-steroid 4-dehydrogenase 1
• EC 1.3.1.22
• EC 1.3.99.5,3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
• S5AR 1
• SR type 1
• SRD5A1
• Steroid 5-alpha-reductase 1,5-alpha reductase
• steroid 5-alpha-reductase type I
• steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 1)

Background

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). There are 2 isoforms of the enzyme: SRD5A1 and SRD5A2 (MIM 607306).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SRD5A1