SPTLC1 Antibody

Western Blot: SPTLC1 Antibody [NBP1-59643] - HepG2 cell lysate, concentration 0.5ug/ml.

Immunohistochemistry-Paraffin: SPTLC1 Antibody [NBP1-59643] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: SPTLC1 Antibody [NBP1-59643] - SPTLC1 levels in human neuroblastoma cells. Cells were untreated or treated with various drugs. Image from verified customer review.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SPTLC1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPTLC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SPTLC1 and was validated on Western Blot and immunohistochemistry-paraffin
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPTLC1 Antibody

• EC 2.3.1.50
• hereditary sensory neuropathy, type 1
• HSAN1
• LBC1
• LCB 1
• LCB1
• LCB1HSAN
• Long chain base biosynthesis protein 1
• MGC14645
• serine C-palmitoyltransferase
• serine palmitoyltransferase 1
• serine palmitoyltransferase, long chain base subunit 1
• Serine-palmitoyl-CoA transferase 1
• SPT 1
• SPT1
• SPT1HSN1
• SPTI
• SPTLC1

Background

Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPTLC1
• Uniprot:
  • O15269(Human)