SPTLC1 Antibody


Western Blot: SPTLC1 Antibody [NBP1-59643] - HepG2 cell lysate, concentration 0.5ug/ml.
Immunohistochemistry-Paraffin: SPTLC1 Antibody [NBP1-59643] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: SPTLC1 Antibody [NBP1-59643] - SPTLC1 levels in human neuroblastoma cells. Cells were untreated or treated with various drugs. Image from verified customer review.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SPTLC1 Antibody Summary

Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SPTLC1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPTLC1 Antibody

  • EC
  • hereditary sensory neuropathy, type 1
  • HSAN1
  • LBC1
  • LCB 1
  • Long chain base biosynthesis protein 1
  • MGC14645
  • serine C-palmitoyltransferase
  • serine palmitoyltransferase 1
  • serine palmitoyltransferase, long chain base subunit 1
  • Serine-palmitoyl-CoA transferase 1
  • SPT 1
  • SPT1HSN1
  • SPTI


Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPTLC1 Antibody (NBP1-59643) (0)

There are no publications for SPTLC1 Antibody (NBP1-59643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTLC1 Antibody (NBP1-59643) (0)

There are no reviews for SPTLC1 Antibody (NBP1-59643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPTLC1 Antibody (NBP1-59643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SPTLC1 Antibody (NBP1-59643)

Discover related pathways, diseases and genes to SPTLC1 Antibody (NBP1-59643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPTLC1 Antibody (NBP1-59643)

Discover more about diseases related to SPTLC1 Antibody (NBP1-59643).

Pathways for SPTLC1 Antibody (NBP1-59643)

View related products by pathway.

PTMs for SPTLC1 Antibody (NBP1-59643)

Learn more about PTMs related to SPTLC1 Antibody (NBP1-59643).

Blogs on SPTLC1

There are no specific blogs for SPTLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPTLC1 Antibody and receive a gift card or discount.


Gene Symbol SPTLC1