SPSB1 Antibody - Azide and BSA Free

Name: SPSB1 Antibody - Azide and BSA Free
Brand: Novus Biologicals
SKU: H00080176-B01P
Price: 499 USD
Availability: InStock

Submit a Review

Images

(

Enlarge)

Western Blot: SPSB1 Antibody [H00080176-B01P] - Analysis of SPSB1 expression in transfected 293T cell line by SPSB1 polyclonal antibody. Lane 1: SPSB1 transfected lysate(30.14 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB
Clonality	Polyclonal
Host	Mouse
Conjugate	Unconjugated
Format	Azide and BSA Free

Order Details

Novus Biologicals offers 100% Guarantee

SPSB1 Antibody - Azide and BSA Free Summary

Description	Novus Biologicals Mouse SPSB1 Antibody - Azide and BSA Free (H00080176-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen	SPSB1 (AAH15711.1, 1 a.a. - 273 a.a.) full-length human protein. MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDDKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ
Isotype	IgG
Clonality	Polyclonal
Host	Mouse
Gene	SPSB1
Purity	Protein G purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	Western Blot
Application Notes	This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.4)
Preservative	No Preservative
Purity	Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPSB1 Antibody - Azide and BSA Free

novel SPRY domain containing protein
splA/ryanodine receptor domain and SOCS box containing 1
SPRY domain-containing SOCS box protein 1
SSB-1SPRY domain-containing SOCS box protein SSB-1
SSB1SPSB

Background

Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SSB Antibody
(OTI2C8)

NBP1-48002

Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)

Species: Ca, Hu, Pm, Pm

Applications: ICC/IF, IHC, IHC-P, IP, WB

HspA4 Antibody -
BSA Free

NBP1-81696

Immunohistochemistry-Paraffin HspA4 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

SPSB2 Antibody
(1E6) - Azide and BSA ...

H00084727-M01

Western Blot SPSB2 Antibody (1E6) - Azide and BSA Free

Sandwich ELISA SPSB2 Antibody (1E6) - Azide and BSA Free

Species: Hu

Applications: ELISA, IHC, IHC-P, S-ELISA, WB

TRIM21/SSA1
Antibody - BSA Free

NBP1-87122

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

OBFC2A Antibody -
BSA Free

NBP3-47270

Species: Hu, Mu, Rt

Applications: ELISA, WB

CISH/CIS-1
Antibody [Unconjugate

AF3194

Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]

Simple Western CISH/CIS-1 Antibody [Unconjugated]

(1 Review)

(2 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

HSP40/DNAJB1
Antibody (OTI1F9)

NBP2-03433

Immunocytochemistry/ Immunofluorescence HSP40/DNAJB1 Antibody (OTI1F9)

Immunohistochemistry-Paraffin HSP40/DNAJB1 Antibody (OTI1F9)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

DNAJC2 Antibody -
BSA Free

NBP1-82627

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

Rad51 Antibody
(14B4) - Azide and BS ...

NB100-148

(5 Reviews)

(77 Publications)

Species: Ch, Hu, Mu, Rt

Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB

Calreticulin
Antibody - BSA Free

NB600-101

Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free

(29 Publications)

Species: Bv, Ha, Hu, Mu, Pm, Rt

Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB

Recombinant Human
SPSB4 GST (N-Term) Pr ...

H00092369-P01

Species: Hu

Applications: ELISA, AP, PA, WB

VASA Antibody
[Unconjugated]

AF2030

Immunohistochemistry VASA Antibody [Unconjugated]

(58 Publications)

Species: Hu

Applications: IHC, WB

iNOS Antibody -
BSA Free

NB300-605

(3 Reviews)

(143 Publications)

Species: Hu, Mu, Po, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Fibrillarin
Antibody (38F3)

NB300-269

Immunocytochemistry/ Immunofluorescence Fibrillarin Antibody (38F3)

(4 Reviews)

(28 Publications)

Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye

Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB

HGFR/c-MET
Antibody [Unconjugate

AF276

Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]

Knockout Validated HGFR/c-MET Antibody [Unconjugated]

(1 Review)

(60 Publications)

Species: Hu

Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB

PAWR / PAR4
Antibody - BSA Free

NBP1-87338

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Enolase 1 Antibody
(8G8) - Azide and BSA ...

H00002023-M01

(10 Publications)

Species: Fe, Hu

Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB

TROVE2 Antibody -
BSA Free

NBP1-86998

(1 Review)

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, IP, WB

Publications for SPSB1 Antibody (H00080176-B01P) (0)

There are no publications for SPSB1 Antibody (H00080176-B01P).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPSB1 Antibody (H00080176-B01P) (0)

There are no reviews for SPSB1 Antibody (H00080176-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPSB1 Antibody (H00080176-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional SPSB1 Products

Research Areas for SPSB1 Antibody (H00080176-B01P)

Find related products by research area.

Signal Transduction

Blogs on SPSB1

There are no specific blogs for SPSB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]

Mouse IgG Isotype Control
NBP1-97019-5mg

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our SPSB1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol	SPSB1
Uniprot	AAH15711(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SPSB1 Antibody - Azide and BSA Free

Species Glossary

Images

Product Details

Order Details

SPSB1 Antibody - Azide and BSA Free Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for SPSB1 Antibody - Azide and BSA Free

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SPSB1 Antibody (H00080176-B01P) (0)

Reviews for SPSB1 Antibody (H00080176-B01P) (0)

Product General Protocols

Video Protocols

FAQs for SPSB1 Antibody (H00080176-B01P) (0)

Secondary Antibodies

Isotype Controls

Additional SPSB1 Products

Research Areas for SPSB1 Antibody (H00080176-B01P)

Blogs on SPSB1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics