SPRTN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPRTN Antibody [NBP1-84163] - C1orf124 Antibody [NBP1-84163] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPRTN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT
Specificity
Specificity of human C1orf124 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPRTN Recombinant Protein Antigen (NBP1-84163PEP)
Publications
Read Publications using NBP1-84163.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPRTN Antibody

  • C1orf124
  • chromosome 1 open reading frame 124
  • DDDL1880
  • dJ876B10.3
  • DKFZP547N043
  • PRO4323
  • RP5-876B10.3
  • Spartan
  • SprT-like N-terminal domain
  • zinc finger RAD18 domain-containing protein C1orf124

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-00990
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43760
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP2-45472
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB163
Species: Hu
Applications: WB, IHC
NLS5411
Species: Hu, Mu, Rt, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
NBP2-67917
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
H00010721-M09
Species: Hu
Applications: WB, ELISA
NBP1-84163
Species: Hu
Applications: ICC/IF

Publications for SPRTN Antibody (NBP1-84163)(2)

Reviews for SPRTN Antibody (NBP1-84163) (0)

There are no reviews for SPRTN Antibody (NBP1-84163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPRTN Antibody (NBP1-84163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPRTN Products

Bioinformatics Tool for SPRTN Antibody (NBP1-84163)

Discover related pathways, diseases and genes to SPRTN Antibody (NBP1-84163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPRTN

There are no specific blogs for SPRTN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRTN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRTN