Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Analysis of SGMS2 expression in human stomach.

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Western blot analysis of MGC26963 over-expressed 293 cell line,cotransfected with MGC26963 Validated Chimera RNAi or non-transfected control. Blot probed with H00166929-M08. GAPDH(36.1 kDa)used as loading control.

Western Blot: Sphingomyelin Synthase 2 Antibody (7D10) [H00166929-M08] - Analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody (M08), clone 7D10. Lane 1: MGC26963 transfected lysatE (42.3 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 7D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free Summary

• Immunogen: Sphingomyelin Synthase 2 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
• Specificity: MGC26963 (7D10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SGMS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500RNAi Validation
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sphingomyelin Synthase 2 Antibody (7D10) - Azide and BSA Free

• EC 2.7.8.27
• phosphatidylcholine:ceramide cholinephosphotransferase 2
• SM synthase
• sphingomyelin synthase 2SMS2MGC26963

Background

Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SGMS2
• Entrez:
  • 166929(Human)
• Uniprot:
  • NP_689834(Human)