RASSF3 Antibody

Images

 
Western Blot: RASSF3 Antibody [NBP1-89425] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: RASSF3 Antibody [NBP1-89425] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: RASSF3 Antibody [NBP1-89425] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF3 Protein (NBP1-89425PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASSF3 Antibody

  • MGC119194
  • MGC119195
  • MGC119197
  • Ras association (RalGDS/AF-6) domain family 3
  • Ras association (RalGDS/AF-6) domain family member 3
  • ras association domain-containing protein 3
  • RASSF5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-89249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55145
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF4264
Species: Hu
Applications: WB

Publications for RASSF3 Antibody (NBP1-89425) (0)

There are no publications for RASSF3 Antibody (NBP1-89425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF3 Antibody (NBP1-89425) (0)

There are no reviews for RASSF3 Antibody (NBP1-89425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF3 Antibody (NBP1-89425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF3 Products

Bioinformatics Tool for RASSF3 Antibody (NBP1-89425)

Discover related pathways, diseases and genes to RASSF3 Antibody (NBP1-89425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF3 Antibody (NBP1-89425)

Discover more about diseases related to RASSF3 Antibody (NBP1-89425).
 

Pathways for RASSF3 Antibody (NBP1-89425)

View related products by pathway.

PTMs for RASSF3 Antibody (NBP1-89425)

Learn more about PTMs related to RASSF3 Antibody (NBP1-89425).

Blogs on RASSF3

There are no specific blogs for RASSF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF3