Flotillin-1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining in human adrenal gland and skin tissues using anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented ...read more
Orthogonal Strategies: Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same ...read more
Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human skin shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Flotillin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:32180897).
Control Peptide
Flotillin-1 Protein (NBP1-87498PEP)
Publications
Read Publications using
NBP1-87498 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23064789)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Flotillin-1 Antibody

  • flotillin 1
  • flotillin-1
  • integral membrane component of caveolae

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-30881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-88561
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
5190-GR
Species: Hu
Applications: BA
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP1-31116
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
236-EG
Species: Hu
Applications: BA
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Flotillin-1 Antibody (NBP1-87498)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Flotillin-1 Antibody (NBP1-87498) (0)

There are no reviews for Flotillin-1 Antibody (NBP1-87498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Flotillin-1 Antibody (NBP1-87498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flotillin-1 Products

Bioinformatics Tool for Flotillin-1 Antibody (NBP1-87498)

Discover related pathways, diseases and genes to Flotillin-1 Antibody (NBP1-87498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flotillin-1 Antibody (NBP1-87498)

Discover more about diseases related to Flotillin-1 Antibody (NBP1-87498).
 

Pathways for Flotillin-1 Antibody (NBP1-87498)

View related products by pathway.

PTMs for Flotillin-1 Antibody (NBP1-87498)

Learn more about PTMs related to Flotillin-1 Antibody (NBP1-87498).
 

Research Areas for Flotillin-1 Antibody (NBP1-87498)

Find related products by research area.

Blogs on Flotillin-1.

Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flotillin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLOT1