Flotillin-1 Antibody

Images

 
Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: Flotillin-1 Antibody [NBP1-87498] - Staining of human stomach shows distinct cytoplasmic and membranous positivity with a granular pattern.
Western Blot: Flotillin-1 Antibody [NBP1-87498] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Flotillin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Flotillin-1 Protein (NBP1-87498PEP)
Publications
Read Publication using NBP1-87498.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23064789)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Flotillin-1 Antibody

  • flotillin 1
  • flotillin-1
  • integral membrane component of caveolae

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87498
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Flotillin-1 Antibody (NBP1-87498)(1)

Reviews for Flotillin-1 Antibody (NBP1-87498) (0)

There are no reviews for Flotillin-1 Antibody (NBP1-87498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flotillin-1 Antibody (NBP1-87498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flotillin-1 Products

Bioinformatics Tool for Flotillin-1 Antibody (NBP1-87498)

Discover related pathways, diseases and genes to Flotillin-1 Antibody (NBP1-87498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flotillin-1 Antibody (NBP1-87498)

Discover more about diseases related to Flotillin-1 Antibody (NBP1-87498).
 

Pathways for Flotillin-1 Antibody (NBP1-87498)

View related products by pathway.

PTMs for Flotillin-1 Antibody (NBP1-87498)

Learn more about PTMs related to Flotillin-1 Antibody (NBP1-87498).

Blogs on Flotillin-1

There are no specific blogs for Flotillin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flotillin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLOT1