SNW1 Antibody

Images

 
Western Blot: SNW1 Antibody [NBP1-88523] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: SNW1 Antibody [NBP1-88523] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human liver shows strong nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: SNW1 Antibody [NBP1-88523] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNW1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
Specificity
Specificity of human, mouse, rat SNW1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNW1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNW1 Protein (NBP1-88523PEP)
Publications
Read Publication using NBP1-88523.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNW1 Antibody

  • Bx42
  • homolog of Drosophila BX42
  • MGC119379
  • NCoA-62
  • Nuclear protein SkiP
  • Nuclear receptor coactivator NCoA-62
  • nuclear receptor coactivator, 62-kD
  • Prp45
  • PRPF45
  • SKI interacting protein
  • Ski-interacting protein
  • SKIPSKIIP
  • SNW domain containing 1
  • SNW domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77305
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-92637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NBP3-00253
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67811
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-51531
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00003636-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SNW1 Antibody (NBP1-88523)(1)


Reviews for SNW1 Antibody (NBP1-88523) (0)

There are no reviews for SNW1 Antibody (NBP1-88523). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNW1 Antibody (NBP1-88523) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNW1 Products

Bioinformatics Tool for SNW1 Antibody (NBP1-88523)

Discover related pathways, diseases and genes to SNW1 Antibody (NBP1-88523). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNW1 Antibody (NBP1-88523)

Discover more about diseases related to SNW1 Antibody (NBP1-88523).
 

Pathways for SNW1 Antibody (NBP1-88523)

View related products by pathway.

PTMs for SNW1 Antibody (NBP1-88523)

Learn more about PTMs related to SNW1 Antibody (NBP1-88523).

Blogs on SNW1

There are no specific blogs for SNW1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNW1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNW1