SPC18 Antibody - Azide and BSA Free

Western Blot: SPC18 Antibody [NBP2-94187] - Analysis of extracts of various cell lines, using SPC18 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: SPC18 Antibody - Azide and BSA Free [NBP2-94187] - Immunofluorescence analysis of L929 cells using SPC18 Rabbit pAb (A10552) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SPC18 Antibody - Azide and BSA Free [NBP2-94187] - Immunofluorescence analysis of U2OS cells using SPC18 Rabbit pAb (A10552) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SPC18 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SPC18 Antibody - Azide and BSA Free (NBP2-94187) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1). KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC11A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SPC18 Antibody - Azide and BSA Free

• EC 3.4
• Endopeptidase SP18
• Microsomal signal peptidase 18 kDa subunit
• SEC11 homolog A (S. cerevisiae)
• SEC11 homolog A
• SEC11L1
• SEC11-like 1
• SEC11-like protein 1
• sid2895
• signal peptidase complex (18kD)
• signal peptidase complex catalytic subunit SEC11A
• SPase 18 kDa subunit
• SPC18SEC11-like 1 (S. cerevisiae)
• SPCS4A1810012E07Rik

Background

SPC18 is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SEC11A