SEC11C Antibody

Images

 
Western Blot: SEC11C Antibody [NBP1-80774] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC11C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Specificity
Specificity of human SEC11C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC11C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEC11C Protein (NBP1-80774PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC11C Antibody

  • EC 3.4
  • Microsomal signal peptidase 21 kDa subunit
  • SEC11 homolog C (S. cerevisiae)
  • SEC11 homolog C
  • SEC11L3
  • SEC11-like protein 3
  • signal peptidase complex catalytic subunit SEC11C
  • SPase 21 kDa subunit
  • SPC21SEC11-like 3 (S. cerevisiae)
  • SPCS4CSEC11-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66212
Species: Hu
NBP2-65864
Species: Hu
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65741
Species: Hu
NBP2-14870
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-80774
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SEC11C Antibody (NBP1-80774) (0)

There are no publications for SEC11C Antibody (NBP1-80774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC11C Antibody (NBP1-80774) (0)

There are no reviews for SEC11C Antibody (NBP1-80774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC11C Antibody (NBP1-80774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SEC11C Antibody (NBP1-80774)

Discover related pathways, diseases and genes to SEC11C Antibody (NBP1-80774). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SEC11C

There are no specific blogs for SEC11C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC11C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC11C