SEC11C Antibody - BSA Free

Western Blot: SEC11C Antibody [NBP1-80774] - Analysis in control (vector only transfected HEK293T lysate) and SEC11C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Pancreas shows strong positivity in endoplasmic reticulum in exocrine glandular cells.

Western Blot: SEC11C Antibody [NBP1-80774] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Kidney shows moderate positivity in endoplasmic reticulum in cells in tubules.

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEC11C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC11C Antibody - BSA Free (NBP1-80774) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SEC11C Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC11C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SEC11C Protein (NBP1-80774PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SEC11C Antibody - BSA Free

• EC 3.4
• Microsomal signal peptidase 21 kDa subunit
• SEC11 homolog C (S. cerevisiae)
• SEC11 homolog C
• SEC11L3
• SEC11-like protein 3
• signal peptidase complex catalytic subunit SEC11C
• SPase 21 kDa subunit
• SPC21SEC11-like 3 (S. cerevisiae)
• SPCS4CSEC11-like 3

Background

SEC11C is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins asthey are translocated into the lumen of the endoplasmic reticulum

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC11C Antibody (NBP1-80774)(4)

Publications using NBP1-80774

• Simon F, Donhauser N, Kemeter L et al. HTLV-1 p12 is cleaved to p8 by the signal peptidase complex and its inhibition impairs p8-dependent transmission. PLoS pathogens 2025-10-10 [PMID: 41071809]
• Iqbal Dulloo, Michael Tellier, Clémence Levet, Anissa Chikh, Boyan Zhang, Diana C Blaydon, Catherine M Webb, David P Kelsell, Matthew Freeman Cleavage of the pseudoprotease iRhom2 by the signal peptidase complex reveals an ER-to-nucleus signaling pathway. Molecular cell 2024-01-18 [PMID: 38183983]
• Sun S, Hou H, Ma G et al. The interaction between E3 ubiquitin ligase Parkin and mitophagy receptor PHB2 links inner mitochondrial membrane ubiquitination to efficient mitophagy The Journal of biological chemistry 2022-11-12 [PMID: 36379251] (WB, Human)
• Porciello N, Cipria D, Masi G et al. Role of the membrane anchor in the regulation of Lck activity The Journal of biological chemistry 2022-11-10 [PMID: 36372231] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: SEC11C
• Entrez:
  • 90701(Human)