SPATA2 Antibody

Images

 
Immunohistochemistry-Paraffin: SPATA2 Antibody [NBP2-13369] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAK ESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPATA2 Protein (NBP2-13369PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA2 Antibody

  • KIAA0757FLJ13167
  • PD1spermatogenesis associated PD1
  • spermatogenesis associated 2
  • spermatogenesis-associated protein 2
  • Spermatogenesis-associated protein PD1
  • tamo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB600-273
Species: Hu, Mu, Rt
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13369
Species: Hu
Applications: IHC, IHC-P

Publications for SPATA2 Antibody (NBP2-13369) (0)

There are no publications for SPATA2 Antibody (NBP2-13369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA2 Antibody (NBP2-13369) (0)

There are no reviews for SPATA2 Antibody (NBP2-13369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPATA2 Antibody (NBP2-13369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA2 Products

Bioinformatics Tool for SPATA2 Antibody (NBP2-13369)

Discover related pathways, diseases and genes to SPATA2 Antibody (NBP2-13369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA2 Antibody (NBP2-13369)

Discover more about diseases related to SPATA2 Antibody (NBP2-13369).
 

Pathways for SPATA2 Antibody (NBP2-13369)

View related products by pathway.

Blogs on SPATA2

There are no specific blogs for SPATA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA2